BLASTX nr result
ID: Akebia25_contig00016116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00016116 (578 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352652.1| PREDICTED: tobamovirus multiplication protei... 56 6e-06 >ref|XP_006352652.1| PREDICTED: tobamovirus multiplication protein 1-like [Solanum tuberosum] Length = 292 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 556 LSEILPSALVFYILCKLPPKRVSAQYHPIH 467 L EILPSALV YIL KLPPKRVSAQYHPIH Sbjct: 263 LVEILPSALVLYILRKLPPKRVSAQYHPIH 292