BLASTX nr result
ID: Akebia25_contig00013005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00013005 (500 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633341.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 emb|CAN78867.1| hypothetical protein VITISV_041982 [Vitis vinifera] 59 7e-07 ref|XP_006856878.1| hypothetical protein AMTR_s00055p00197790 [A... 57 4e-06 >ref|XP_003633341.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Vitis vinifera] Length = 822 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +1 Query: 1 KFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 129 K LHIMES+N TPN QTYVIL REL++ KSIE++ +ADKL + Sbjct: 775 KLLHIMESKNFTPNIQTYVILGRELSRIGKSIESEPLADKLKV 817 >emb|CAN78867.1| hypothetical protein VITISV_041982 [Vitis vinifera] Length = 962 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +1 Query: 1 KFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 129 K LHIMES+N TPN QTYVIL REL++ KSIE++ +ADKL + Sbjct: 915 KLLHIMESKNFTPNIQTYVILGRELSRIGKSIESEPLADKLKV 957 >ref|XP_006856878.1| hypothetical protein AMTR_s00055p00197790 [Amborella trichopoda] gi|548860812|gb|ERN18345.1| hypothetical protein AMTR_s00055p00197790 [Amborella trichopoda] Length = 940 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 1 KFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADK 120 KFLH ME + TPNFQTYVILARE++KE+K ET+ +A+K Sbjct: 892 KFLHEMEEKGCTPNFQTYVILAREMSKEDKLPETELLANK 931