BLASTX nr result
ID: Akebia25_contig00009624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00009624 (723 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG16881.1| hypothetical protein MPH_05862 [Macrophomina phas... 75 3e-11 ref|XP_007587342.1| hypothetical protein UCRNP2_8096 [Neofusicoc... 72 1e-10 ref|XP_007585765.1| hypothetical protein UCRNP2_6505 [Neofusicoc... 66 1e-08 gb|EKG22411.1| hypothetical protein MPH_00145 [Macrophomina phas... 58 3e-06 >gb|EKG16881.1| hypothetical protein MPH_05862 [Macrophomina phaseolina MS6] Length = 83 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = -3 Query: 616 DEKKGYVPPPSIGHELGVMFGFIGFMLLAFILYAVVFSIYNKRWERKEQDRLAALRASGY 437 D+ YVP PS+GHELG++FGF+ M++ Y VV+ I NKR RKEQ+R+AALRASG+ Sbjct: 8 DKSLCYVPMPSLGHELGILFGFVALMIICMAAYGVVWQIGNKRSLRKEQERIAALRASGH 67 >ref|XP_007587342.1| hypothetical protein UCRNP2_8096 [Neofusicoccum parvum UCRNP2] gi|485918532|gb|EOD45177.1| hypothetical protein UCRNP2_8096 [Neofusicoccum parvum UCRNP2] Length = 81 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/55 (58%), Positives = 43/55 (78%) Frame = -3 Query: 601 YVPPPSIGHELGVMFGFIGFMLLAFILYAVVFSIYNKRWERKEQDRLAALRASGY 437 YVP PS+GHELG+MFGF+ M++ Y VV+ + N+R RKEQ+R+AALRASG+ Sbjct: 13 YVPMPSLGHELGIMFGFLALMVVCMAAYGVVWQVGNRRSLRKEQERIAALRASGH 67 >ref|XP_007585765.1| hypothetical protein UCRNP2_6505 [Neofusicoccum parvum UCRNP2] gi|485920887|gb|EOD46763.1| hypothetical protein UCRNP2_6505 [Neofusicoccum parvum UCRNP2] Length = 102 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = -3 Query: 604 GYVPPPSIGHELGVMFGFIGFMLLAFILYAVVFSIYNKRWERKEQDRLAALRASG 440 GYVPPPS+GHE+GVMFG IG MLL +L+ + IY K+ E+KE+ R+ LR G Sbjct: 26 GYVPPPSVGHEIGVMFGGIGLMLLGMLLFWSWWQIYLKQEEKKERKRVEDLRQRG 80 >gb|EKG22411.1| hypothetical protein MPH_00145 [Macrophomina phaseolina MS6] Length = 88 Score = 58.2 bits (139), Expect = 3e-06 Identities = 32/62 (51%), Positives = 38/62 (61%) Frame = -3 Query: 604 GYVPPPSIGHELGVMFGFIGFMLLAFILYAVVFSIYNKRWERKEQDRLAALRASGYGPVD 425 GYVP PS GHE+GVMFG IG MLL +L+ + I KR E KE+ R+ LR G Sbjct: 24 GYVPAPSTGHEIGVMFGGIGAMLLGMLLFWSWWQIKLKRDEAKERKRVDGLRQRGLLKEQ 83 Query: 424 EK 419 EK Sbjct: 84 EK 85