BLASTX nr result
ID: Akebia24_contig00048907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00048907 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604379.1| Glucan endo-1,3-beta-glucosidase [Medicago t... 56 5e-06 ref|XP_006597118.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 55 8e-06 ref|XP_006597117.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 55 8e-06 >ref|XP_003604379.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula] gi|355505434|gb|AES86576.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula] Length = 391 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 179 GFEKTEVIVSETGWASHGDENEVGATLQNA 90 GF+K EVIVSETGWASHGD+NE GAT++NA Sbjct: 261 GFDKMEVIVSETGWASHGDDNEAGATVKNA 290 >ref|XP_006597118.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X2 [Glycine max] Length = 377 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 179 GFEKTEVIVSETGWASHGDENEVGATLQNA 90 GF+K +VIVSETGWASHGD+NE GAT++NA Sbjct: 258 GFDKMDVIVSETGWASHGDDNEAGATIKNA 287 >ref|XP_006597117.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X1 [Glycine max] Length = 386 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 179 GFEKTEVIVSETGWASHGDENEVGATLQNA 90 GF+K +VIVSETGWASHGD+NE GAT++NA Sbjct: 258 GFDKMDVIVSETGWASHGDDNEAGATIKNA 287