BLASTX nr result
ID: Akebia24_contig00048903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00048903 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526651.1| transferase, transferring glycosyl groups, p... 101 1e-19 gb|ADK87343.1| callose synthase 7 [Arabidopsis thaliana] 99 8e-19 ref|XP_006484915.1| PREDICTED: callose synthase 7-like isoform X... 99 8e-19 ref|XP_006484914.1| PREDICTED: callose synthase 7-like isoform X... 99 8e-19 ref|XP_006484913.1| PREDICTED: callose synthase 7-like isoform X... 99 8e-19 ref|XP_006484912.1| PREDICTED: callose synthase 7-like isoform X... 99 8e-19 ref|XP_006437120.1| hypothetical protein CICLE_v10030560mg [Citr... 99 8e-19 ref|XP_006437119.1| hypothetical protein CICLE_v10030560mg [Citr... 99 8e-19 gb|AAF24822.1|AC007592_15 F12K11.17 [Arabidopsis thaliana] 99 8e-19 ref|NP_172136.2| callose synthase 7 [Arabidopsis thaliana] gi|33... 99 8e-19 ref|XP_007214897.1| hypothetical protein PRUPE_ppa000077mg [Prun... 98 1e-18 gb|EYU32396.1| hypothetical protein MIMGU_mgv1a024191mg [Mimulus... 97 2e-18 ref|XP_006484888.1| PREDICTED: callose synthase 7-like isoform X... 96 5e-18 ref|XP_006484887.1| PREDICTED: callose synthase 7-like isoform X... 96 5e-18 ref|XP_006484886.1| PREDICTED: callose synthase 7-like isoform X... 96 5e-18 ref|XP_006437159.1| hypothetical protein CICLE_v10030495mg [Citr... 96 5e-18 ref|XP_006437155.1| hypothetical protein CICLE_v10030478mg [Citr... 96 5e-18 ref|XP_006437154.1| hypothetical protein CICLE_v10030478mg [Citr... 96 5e-18 ref|XP_006417911.1| hypothetical protein EUTSA_v10006529mg [Eutr... 96 5e-18 gb|EXB92390.1| Callose synthase 7 [Morus notabilis] 94 1e-17 >ref|XP_002526651.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223534018|gb|EEF35739.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1911 Score = 101 bits (251), Expect = 1e-19 Identities = 51/84 (60%), Positives = 63/84 (75%) Frame = +2 Query: 5 DVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLME 184 DV+ +K IINVLQDI+EIITQDVMI+G +LE +H + KK ++F K+ +DL + Sbjct: 954 DVDAYKSQIINVLQDIIEIITQDVMIHGHDVLERAHPTNVDVHNSKKEQRFGKINIDLTK 1013 Query: 185 NRSWMEKVVRLHLLLTVKESAINV 256 N SW EKVVRLHLLLT KESAINV Sbjct: 1014 NSSWREKVVRLHLLLTTKESAINV 1037 >gb|ADK87343.1| callose synthase 7 [Arabidopsis thaliana] Length = 1933 Score = 98.6 bits (244), Expect = 8e-19 Identities = 50/82 (60%), Positives = 63/82 (76%) Frame = +2 Query: 11 NEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLMENR 190 +++K IINVLQDI+EIITQDVM+NG ILE +H Q + KK ++F+K+ L L +N Sbjct: 969 DDYKSQIINVLQDIIEIITQDVMVNGHEILERAHLQSGDIESDKKEQRFEKIDLSLTQNI 1028 Query: 191 SWMEKVVRLHLLLTVKESAINV 256 SW EKVVRL LLLTVKESAIN+ Sbjct: 1029 SWREKVVRLLLLLTVKESAINI 1050 >ref|XP_006484915.1| PREDICTED: callose synthase 7-like isoform X4 [Citrus sinensis] Length = 1904 Score = 98.6 bits (244), Expect = 8e-19 Identities = 51/85 (60%), Positives = 65/85 (76%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 EDV+ +K IIN LQDIM+II QD+M+NG ILE H Q Q++ K+ + F+KL + +M Sbjct: 939 EDVDVYKSQIINFLQDIMKIILQDIMVNGFEILERFHTQIQNND--KEEQIFEKLNITIM 996 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 EN+SW EKVVRLH LLTVKESA+NV Sbjct: 997 ENKSWREKVVRLHFLLTVKESAVNV 1021 >ref|XP_006484914.1| PREDICTED: callose synthase 7-like isoform X3 [Citrus sinensis] Length = 1535 Score = 98.6 bits (244), Expect = 8e-19 Identities = 51/85 (60%), Positives = 65/85 (76%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 EDV+ +K IIN LQDIM+II QD+M+NG ILE H Q Q++ K+ + F+KL + +M Sbjct: 580 EDVDVYKSQIINFLQDIMKIILQDIMVNGFEILERFHTQIQNND--KEEQIFEKLNITIM 637 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 EN+SW EKVVRLH LLTVKESA+NV Sbjct: 638 ENKSWREKVVRLHFLLTVKESAVNV 662 >ref|XP_006484913.1| PREDICTED: callose synthase 7-like isoform X2 [Citrus sinensis] Length = 1544 Score = 98.6 bits (244), Expect = 8e-19 Identities = 51/85 (60%), Positives = 65/85 (76%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 EDV+ +K IIN LQDIM+II QD+M+NG ILE H Q Q++ K+ + F+KL + +M Sbjct: 579 EDVDVYKSQIINFLQDIMKIILQDIMVNGFEILERFHTQIQNND--KEEQIFEKLNITIM 636 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 EN+SW EKVVRLH LLTVKESA+NV Sbjct: 637 ENKSWREKVVRLHFLLTVKESAVNV 661 >ref|XP_006484912.1| PREDICTED: callose synthase 7-like isoform X1 [Citrus sinensis] Length = 1545 Score = 98.6 bits (244), Expect = 8e-19 Identities = 51/85 (60%), Positives = 65/85 (76%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 EDV+ +K IIN LQDIM+II QD+M+NG ILE H Q Q++ K+ + F+KL + +M Sbjct: 580 EDVDVYKSQIINFLQDIMKIILQDIMVNGFEILERFHTQIQNND--KEEQIFEKLNITIM 637 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 EN+SW EKVVRLH LLTVKESA+NV Sbjct: 638 ENKSWREKVVRLHFLLTVKESAVNV 662 >ref|XP_006437120.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] gi|557539316|gb|ESR50360.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] Length = 1130 Score = 98.6 bits (244), Expect = 8e-19 Identities = 51/85 (60%), Positives = 65/85 (76%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 EDV+ +K IIN LQDIM+II QD+M+NG ILE H Q Q++ K+ + F+KL + +M Sbjct: 165 EDVDVYKSQIINFLQDIMKIILQDIMVNGFEILERFHTQIQNND--KEEQIFEKLNITIM 222 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 EN+SW EKVVRLH LLTVKESA+NV Sbjct: 223 ENKSWREKVVRLHFLLTVKESAVNV 247 >ref|XP_006437119.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] gi|557539315|gb|ESR50359.1| hypothetical protein CICLE_v10030560mg [Citrus clementina] Length = 1027 Score = 98.6 bits (244), Expect = 8e-19 Identities = 51/85 (60%), Positives = 65/85 (76%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 EDV+ +K IIN LQDIM+II QD+M+NG ILE H Q Q++ K+ + F+KL + +M Sbjct: 165 EDVDVYKSQIINFLQDIMKIILQDIMVNGFEILERFHTQIQNND--KEEQIFEKLNITIM 222 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 EN+SW EKVVRLH LLTVKESA+NV Sbjct: 223 ENKSWREKVVRLHFLLTVKESAVNV 247 >gb|AAF24822.1|AC007592_15 F12K11.17 [Arabidopsis thaliana] Length = 1930 Score = 98.6 bits (244), Expect = 8e-19 Identities = 50/82 (60%), Positives = 63/82 (76%) Frame = +2 Query: 11 NEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLMENR 190 +++K IINVLQDI+EIITQDVM+NG ILE +H Q + KK ++F+K+ L L +N Sbjct: 966 DDYKSQIINVLQDIIEIITQDVMVNGHEILERAHLQSGDIESDKKEQRFEKIDLSLTQNI 1025 Query: 191 SWMEKVVRLHLLLTVKESAINV 256 SW EKVVRL LLLTVKESAIN+ Sbjct: 1026 SWREKVVRLLLLLTVKESAINI 1047 >ref|NP_172136.2| callose synthase 7 [Arabidopsis thaliana] gi|334302882|sp|Q9SHJ3.3|CALS7_ARATH RecName: Full=Callose synthase 7; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 7 gi|332189872|gb|AEE27993.1| callose synthase 7 [Arabidopsis thaliana] Length = 1958 Score = 98.6 bits (244), Expect = 8e-19 Identities = 50/82 (60%), Positives = 63/82 (76%) Frame = +2 Query: 11 NEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLMENR 190 +++K IINVLQDI+EIITQDVM+NG ILE +H Q + KK ++F+K+ L L +N Sbjct: 969 DDYKSQIINVLQDIIEIITQDVMVNGHEILERAHLQSGDIESDKKEQRFEKIDLSLTQNI 1028 Query: 191 SWMEKVVRLHLLLTVKESAINV 256 SW EKVVRL LLLTVKESAIN+ Sbjct: 1029 SWREKVVRLLLLLTVKESAINI 1050 >ref|XP_007214897.1| hypothetical protein PRUPE_ppa000077mg [Prunus persica] gi|462411047|gb|EMJ16096.1| hypothetical protein PRUPE_ppa000077mg [Prunus persica] Length = 1929 Score = 98.2 bits (243), Expect = 1e-18 Identities = 53/85 (62%), Positives = 63/85 (74%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 E+V IINVLQDIMEIITQDVM+NG ILE +H Q+ KK ++FQK+ + L Sbjct: 963 ENVENSMRQIINVLQDIMEIITQDVMVNGHQILEAAHYID--GQNVKKEQRFQKINIFLT 1020 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 +N +W EKVVRLHLLLTVKESAINV Sbjct: 1021 QNTAWREKVVRLHLLLTVKESAINV 1045 >gb|EYU32396.1| hypothetical protein MIMGU_mgv1a024191mg [Mimulus guttatus] Length = 1907 Score = 97.1 bits (240), Expect = 2e-18 Identities = 49/85 (57%), Positives = 65/85 (76%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 ED ++ IIN+LQDI+EII QDVM NG +LE +H D K+ +KF+++++DL+ Sbjct: 945 EDAQLYRSQIINMLQDIIEIIIQDVMNNGHEVLEKTHSLHH---DEKREQKFERVKIDLL 1001 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 ++ SWMEKVVRLHLLLTVKESAINV Sbjct: 1002 QSGSWMEKVVRLHLLLTVKESAINV 1026 >ref|XP_006484888.1| PREDICTED: callose synthase 7-like isoform X3 [Citrus sinensis] Length = 1890 Score = 95.9 bits (237), Expect = 5e-18 Identities = 51/85 (60%), Positives = 63/85 (74%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 E +K IINVLQDIMEII QD+M+NG ILE H Q Q + KK ++F++L + L Sbjct: 928 ESEEVYKSQIINVLQDIMEIILQDIMVNGYKILERYHMQIQTND--KKEQRFERLNITLT 985 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 +N+SW EKVVRL+LLLTVKESAINV Sbjct: 986 QNKSWREKVVRLYLLLTVKESAINV 1010 >ref|XP_006484887.1| PREDICTED: callose synthase 7-like isoform X2 [Citrus sinensis] Length = 1922 Score = 95.9 bits (237), Expect = 5e-18 Identities = 51/85 (60%), Positives = 63/85 (74%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 E +K IINVLQDIMEII QD+M+NG ILE H Q Q + KK ++F++L + L Sbjct: 960 ESEEVYKSQIINVLQDIMEIILQDIMVNGYKILERYHMQIQTND--KKEQRFERLNITLT 1017 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 +N+SW EKVVRL+LLLTVKESAINV Sbjct: 1018 QNKSWREKVVRLYLLLTVKESAINV 1042 >ref|XP_006484886.1| PREDICTED: callose synthase 7-like isoform X1 [Citrus sinensis] Length = 1924 Score = 95.9 bits (237), Expect = 5e-18 Identities = 51/85 (60%), Positives = 63/85 (74%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 E +K IINVLQDIMEII QD+M+NG ILE H Q Q + KK ++F++L + L Sbjct: 962 ESEEVYKSQIINVLQDIMEIILQDIMVNGYKILERYHMQIQTND--KKEQRFERLNITLT 1019 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 +N+SW EKVVRL+LLLTVKESAINV Sbjct: 1020 QNKSWREKVVRLYLLLTVKESAINV 1044 >ref|XP_006437159.1| hypothetical protein CICLE_v10030495mg [Citrus clementina] gi|557539355|gb|ESR50399.1| hypothetical protein CICLE_v10030495mg [Citrus clementina] Length = 1554 Score = 95.9 bits (237), Expect = 5e-18 Identities = 51/83 (61%), Positives = 63/83 (75%) Frame = +2 Query: 8 VNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLMEN 187 V+ +K IINVLQDIMEII QD+M+NG ILE H Q Q + KK ++F++L + L +N Sbjct: 603 VDVYKSQIINVLQDIMEIILQDIMVNGFKILERYHVQIQSNY--KKEQRFERLNIALTQN 660 Query: 188 RSWMEKVVRLHLLLTVKESAINV 256 +SW EKVVRLHLL TVKESAINV Sbjct: 661 KSWREKVVRLHLLFTVKESAINV 683 >ref|XP_006437155.1| hypothetical protein CICLE_v10030478mg [Citrus clementina] gi|557539351|gb|ESR50395.1| hypothetical protein CICLE_v10030478mg [Citrus clementina] Length = 1776 Score = 95.9 bits (237), Expect = 5e-18 Identities = 51/85 (60%), Positives = 63/85 (74%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 E +K IINVLQDIMEII QD+M+NG ILE H Q Q + KK ++F++L + L Sbjct: 814 ESEEVYKSQIINVLQDIMEIILQDIMVNGYKILERYHMQIQTND--KKEQRFERLNITLT 871 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 +N+SW EKVVRL+LLLTVKESAINV Sbjct: 872 QNKSWREKVVRLYLLLTVKESAINV 896 >ref|XP_006437154.1| hypothetical protein CICLE_v10030478mg [Citrus clementina] gi|557539350|gb|ESR50394.1| hypothetical protein CICLE_v10030478mg [Citrus clementina] Length = 1922 Score = 95.9 bits (237), Expect = 5e-18 Identities = 51/85 (60%), Positives = 63/85 (74%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 E +K IINVLQDIMEII QD+M+NG ILE H Q Q + KK ++F++L + L Sbjct: 960 ESEEVYKSQIINVLQDIMEIILQDIMVNGYKILERYHMQIQTND--KKEQRFERLNITLT 1017 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 +N+SW EKVVRL+LLLTVKESAINV Sbjct: 1018 QNKSWREKVVRLYLLLTVKESAINV 1042 >ref|XP_006417911.1| hypothetical protein EUTSA_v10006529mg [Eutrema salsugineum] gi|557095682|gb|ESQ36264.1| hypothetical protein EUTSA_v10006529mg [Eutrema salsugineum] Length = 1934 Score = 95.9 bits (237), Expect = 5e-18 Identities = 49/85 (57%), Positives = 63/85 (74%) Frame = +2 Query: 2 EDVNEFKVPIINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLM 181 E+ +K IINVLQDI+EIITQDVM+NG ILE +H Q + +K ++F+K+ L L Sbjct: 966 EEDETYKSQIINVLQDIIEIITQDVMVNGHEILERAHFQSGDIESDRKEQRFEKINLGLT 1025 Query: 182 ENRSWMEKVVRLHLLLTVKESAINV 256 +N SW EKVVRL LL+TVKESAIN+ Sbjct: 1026 KNVSWREKVVRLLLLVTVKESAINI 1050 >gb|EXB92390.1| Callose synthase 7 [Morus notabilis] Length = 1956 Score = 94.4 bits (233), Expect = 1e-17 Identities = 47/76 (61%), Positives = 58/76 (76%) Frame = +2 Query: 29 IINVLQDIMEIITQDVMINGRSILEISHQQKQHSQDPKKGEKFQKLRLDLMENRSWMEKV 208 IINVLQDIMEII +DVM+ G I E H+Q Q KK ++F+K+ + L +N+SW EKV Sbjct: 998 IINVLQDIMEIIIKDVMVYGHEIFEAIHRQNIDVQSDKKEQRFEKIHIQLAKNKSWREKV 1057 Query: 209 VRLHLLLTVKESAINV 256 VRLHLLLTVKESAI+V Sbjct: 1058 VRLHLLLTVKESAISV 1073