BLASTX nr result
ID: Akebia24_contig00048836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00048836 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF17980.1| hypothetical protein SEPMUDRAFT_146869 [Sphaeruli... 66 4e-09 >gb|EMF17980.1| hypothetical protein SEPMUDRAFT_146869 [Sphaerulina musiva SO2202] Length = 140 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +1 Query: 70 AQPKILSHSPPKESEQSNEVKSHNQEVKDRAEGSFQSKEKN 192 AQPKILS SPPKE+EQS++VKSHN+EVK R EG+++SKEK+ Sbjct: 97 AQPKILSESPPKENEQSDDVKSHNKEVKARVEGTYKSKEKD 137