BLASTX nr result
ID: Akebia24_contig00047972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00047972 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prun... 102 6e-20 ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinu... 100 3e-19 ref|XP_004306939.1| PREDICTED: probable pectinesterase/pectinest... 100 4e-19 emb|CBI38888.3| unnamed protein product [Vitis vinifera] 99 5e-19 ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera] 99 5e-19 ref|XP_006347887.1| PREDICTED: pectinesterase 2-like [Solanum tu... 99 6e-19 ref|XP_004229797.1| PREDICTED: pectinesterase 2-like [Solanum ly... 99 6e-19 ref|XP_003521947.1| PREDICTED: pectinesterase 2-like, partial [G... 98 1e-18 ref|XP_003521940.1| PREDICTED: pectinesterase 2-like [Glycine max] 98 1e-18 ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine ma... 98 1e-18 ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera] 98 1e-18 emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera] 98 1e-18 ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vini... 97 2e-18 emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera] 97 2e-18 ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]... 97 3e-18 sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE ... 97 3e-18 ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citr... 97 3e-18 emb|CBI24285.3| unnamed protein product [Vitis vinifera] 97 3e-18 ref|XP_002302526.1| putative pectin methylesterase LuPME1 family... 97 3e-18 ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera] 97 3e-18 >ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica] gi|462417123|gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica] Length = 511 Score = 102 bits (254), Expect = 6e-20 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+NRVKW GY VITSA+EAS+F+V NFIAG+SWLP+TNVPFTSGL Sbjct: 456 GEYMNTGPGSSTSNRVKWAGYHVITSASEASKFTVGNFIAGNSWLPATNVPFTSGL 511 >ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis] gi|223548859|gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis] Length = 514 Score = 100 bits (248), Expect = 3e-19 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS TANRV W GYRVITSA EASQF+V NFI+G+SWLP TNVPFT GL Sbjct: 459 GEYMNTGPGSSTANRVTWKGYRVITSAAEASQFTVQNFISGNSWLPGTNVPFTPGL 514 >ref|XP_004306939.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like [Fragaria vesca subsp. vesca] Length = 508 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+ RVKWGGY VITS++EAS+F+V NFIAG SWLP+TNVPFT+GL Sbjct: 453 GEYMNTGPGSSTSGRVKWGGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL 508 >emb|CBI38888.3| unnamed protein product [Vitis vinifera] Length = 259 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+NRV W GY VITS++EAS+F+V NFIAG+SWLP+TNVPFTSGL Sbjct: 204 GEYMNTGPGSSTSNRVNWAGYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL 259 >ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera] Length = 513 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+NRV W GY VITS++EAS+F+V NFIAG+SWLP+TNVPFTSGL Sbjct: 458 GEYMNTGPGSSTSNRVNWAGYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL 513 >ref|XP_006347887.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum] Length = 516 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEY+NTGPGS T NRV WGGYRVITS+ EAS+F+ +NFIAG+SW+P+TNVPFTSGL Sbjct: 461 GEYLNTGPGSSTGNRVNWGGYRVITSSAEASKFTPANFIAGNSWIPATNVPFTSGL 516 >ref|XP_004229797.1| PREDICTED: pectinesterase 2-like [Solanum lycopersicum] Length = 492 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEY+NTGPGS T NRV WGGYRVITS+ EAS+F+ +NFIAG+SW+P+TNVPFTSGL Sbjct: 437 GEYLNTGPGSSTGNRVNWGGYRVITSSAEASKFTPANFIAGNSWIPATNVPFTSGL 492 >ref|XP_003521947.1| PREDICTED: pectinesterase 2-like, partial [Glycine max] Length = 506 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS TANRV W GY VITSA+EAS+F+V NFIAG+SWLP+T+VPFTSGL Sbjct: 451 GEYMNTGPGSSTANRVNWLGYHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL 506 >ref|XP_003521940.1| PREDICTED: pectinesterase 2-like [Glycine max] Length = 511 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS TANRV W GY VITSA+EAS+F+V NFIAG+SWLP+T+VPFTSGL Sbjct: 456 GEYMNTGPGSSTANRVNWLGYHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL 511 >ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max] gi|356496348|ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max] Length = 515 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS TA RVKW GYRVITSA+EAS+FSV+NFIAG++WLPST VPFT L Sbjct: 460 GEYMNTGPGSSTARRVKWSGYRVITSASEASKFSVANFIAGNAWLPSTKVPFTPSL 515 >ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera] Length = 512 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+ RVKW GY VITS+TEA++F+ NFI+G+SWLPSTNVPFTSGL Sbjct: 457 GEYMNTGPGSSTSGRVKWAGYHVITSSTEAAKFTAGNFISGNSWLPSTNVPFTSGL 512 >emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera] Length = 512 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+ RVKW GY VITS+TEA++F+ NFI+G+SWLPSTNVPFTSGL Sbjct: 457 GEYMNTGPGSSTSGRVKWAGYHVITSSTEAAKFTAGNFISGNSWLPSTNVPFTSGL 512 >ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera] Length = 512 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+ RV W GY VITS+TEA++F+V NFI+G+SWLPSTNVPFTSGL Sbjct: 457 GEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL 512 >emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera] Length = 497 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+ RV W GY VITS+TEA++F+V NFI+G+SWLPSTNVPFTSGL Sbjct: 442 GEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL 497 >ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis] gi|2098713|gb|AAB57671.1| pectinesterase [Citrus sinensis] Length = 510 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = -1 Query: 259 EYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 EYMNTGPGS TANRVKW GY V+TS ++ SQF+V NFIAG+SWLP+TNVPFTSGL Sbjct: 456 EYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL 510 >sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin methylesterase; Flags: Precursor gi|2098709|gb|AAB57669.1| pectinesterase [Citrus sinensis] Length = 510 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = -1 Query: 259 EYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 EYMNTGPGS TANRVKW GY V+TS ++ SQF+V NFIAG+SWLP+TNVPFTSGL Sbjct: 456 EYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL 510 >ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina] gi|557547560|gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina] Length = 510 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = -1 Query: 259 EYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 EYMNTGPGS TANRVKW GY V+TS ++ SQF+V NFIAG+SWLP+TNVPFTSGL Sbjct: 456 EYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL 510 >emb|CBI24285.3| unnamed protein product [Vitis vinifera] Length = 444 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+ RV W GY VITS+TEA++F+V NFI+G+SWLPSTNVPFTSGL Sbjct: 389 GEYMNTGPGSSTSGRVNWTGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL 444 >ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus trichocarpa] gi|222844252|gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus trichocarpa] Length = 514 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS TANRV W GYRVITS+T ASQF+V +FI+G++WLP+TNVPFT+GL Sbjct: 459 GEYMNTGPGSSTANRVNWKGYRVITSSTVASQFTVGSFISGNNWLPATNVPFTAGL 514 >ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera] Length = 513 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -1 Query: 262 GEYMNTGPGSPTANRVKWGGYRVITSATEASQFSVSNFIAGDSWLPSTNVPFTSGL 95 GEYMNTGPGS T+ RV W GY VITS+TEA++F+V NFI+G+SWLPSTNVPFTSGL Sbjct: 458 GEYMNTGPGSSTSGRVNWTGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL 513