BLASTX nr result
ID: Akebia24_contig00047893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00047893 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF08539.1| hypothetical protein SEPMUDRAFT_152176 [Sphaeruli... 81 1e-13 gb|EME83764.1| hypothetical protein MYCFIDRAFT_210699 [Pseudocer... 67 2e-09 >gb|EMF08539.1| hypothetical protein SEPMUDRAFT_152176 [Sphaerulina musiva SO2202] Length = 338 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = +1 Query: 142 AWRLWGKKK-RAAGEGEMFDSQNDSLRKEQRASAQLAGGTGLERYQQPHVNTASNF 306 AWRLWGKKK RA G+ DS + SL+K + + AQLAGGTGLERYQQPHVNTASNF Sbjct: 283 AWRLWGKKKQRAVGQHSYNDSMDHSLQKGESSPAQLAGGTGLERYQQPHVNTASNF 338 >gb|EME83764.1| hypothetical protein MYCFIDRAFT_210699 [Pseudocercospora fijiensis CIRAD86] Length = 306 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/66 (56%), Positives = 44/66 (66%), Gaps = 11/66 (16%) Frame = +1 Query: 142 AWRLWGKKKR-AAGEGEMFDSQNDSLRKEQRASAQLAGGTGLERYQQPH----------V 288 AWR+WG+KKR A + E DSQNDS+RKE ++A G+GLERYQQPH V Sbjct: 246 AWRIWGRKKRPAVPQDEYLDSQNDSIRKE-----RIASGSGLERYQQPHNAPYHNPGGSV 300 Query: 289 NTASNF 306 NTASNF Sbjct: 301 NTASNF 306