BLASTX nr result
ID: Akebia24_contig00047769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00047769 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527053.1| PREDICTED: pentatricopeptide repeat-containi... 131 1e-28 ref|XP_003523047.2| PREDICTED: pentatricopeptide repeat-containi... 129 4e-28 ref|XP_006578589.1| PREDICTED: pentatricopeptide repeat-containi... 129 4e-28 ref|XP_006578590.1| PREDICTED: pentatricopeptide repeat-containi... 129 4e-28 ref|XP_004154991.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 128 7e-28 ref|XP_004138146.1| PREDICTED: pentatricopeptide repeat-containi... 128 7e-28 ref|XP_007210374.1| hypothetical protein PRUPE_ppa001256mg [Prun... 127 2e-27 ref|XP_002511505.1| pentatricopeptide repeat-containing protein,... 127 2e-27 ref|XP_007037187.1| Pentatricopeptide repeat-containing protein,... 127 2e-27 ref|XP_004513211.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|XP_006476670.1| PREDICTED: pentatricopeptide repeat-containi... 125 6e-27 ref|XP_006439668.1| hypothetical protein CICLE_v10018829mg [Citr... 125 6e-27 ref|XP_006390391.1| hypothetical protein EUTSA_v10018113mg [Eutr... 125 8e-27 ref|XP_002321537.1| pentatricopeptide repeat-containing family p... 125 8e-27 gb|EXC34220.1| hypothetical protein L484_010090 [Morus notabilis] 124 1e-26 ref|XP_006300690.1| hypothetical protein CARUB_v10019733mg [Caps... 122 4e-26 ref|XP_006300689.1| hypothetical protein CARUB_v10019733mg [Caps... 122 4e-26 ref|NP_177613.1| pentatricopeptide repeat-containing protein [Ar... 122 4e-26 ref|XP_002266698.1| PREDICTED: pentatricopeptide repeat-containi... 122 5e-26 ref|XP_007157658.1| hypothetical protein PHAVU_002G087700g [Phas... 122 7e-26 >ref|XP_003527053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Glycine max] Length = 882 Score = 131 bits (329), Expect = 1e-28 Identities = 61/71 (85%), Positives = 70/71 (98%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFRRQMLASG+GP+RIDI+TGWGRRS+V GSSLVRQ+V+ELL++F Sbjct: 787 MSDGTAVTALSRTLAWFRRQMLASGVGPNRIDIITGWGRRSRVTGSSLVRQAVQELLHVF 846 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 847 SFPFFTENGNS 857 >ref|XP_003523047.2| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like isoform X1 [Glycine max] Length = 882 Score = 129 bits (324), Expect = 4e-28 Identities = 61/71 (85%), Positives = 69/71 (97%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFRRQMLASG+GP+RIDIVTGWGRRS+V GSSLVRQ+V+ELL++F Sbjct: 787 MSDGTAVTALSRTLAWFRRQMLASGVGPNRIDIVTGWGRRSRVTGSSLVRQAVQELLHVF 846 Query: 181 NFPFFTENGNS 213 +FPFFTEN NS Sbjct: 847 SFPFFTENSNS 857 >ref|XP_006578589.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like isoform X2 [Glycine max] Length = 898 Score = 129 bits (324), Expect = 4e-28 Identities = 61/71 (85%), Positives = 69/71 (97%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFRRQMLASG+GP+RIDIVTGWGRRS+V GSSLVRQ+V+ELL++F Sbjct: 803 MSDGTAVTALSRTLAWFRRQMLASGVGPNRIDIVTGWGRRSRVTGSSLVRQAVQELLHVF 862 Query: 181 NFPFFTENGNS 213 +FPFFTEN NS Sbjct: 863 SFPFFTENSNS 873 >ref|XP_006578590.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like isoform X3 [Glycine max] Length = 879 Score = 129 bits (324), Expect = 4e-28 Identities = 61/71 (85%), Positives = 69/71 (97%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFRRQMLASG+GP+RIDIVTGWGRRS+V GSSLVRQ+V+ELL++F Sbjct: 784 MSDGTAVTALSRTLAWFRRQMLASGVGPNRIDIVTGWGRRSRVTGSSLVRQAVQELLHVF 843 Query: 181 NFPFFTENGNS 213 +FPFFTEN NS Sbjct: 844 SFPFFTENSNS 854 >ref|XP_004154991.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g18900-like [Cucumis sativus] Length = 874 Score = 128 bits (322), Expect = 7e-28 Identities = 61/71 (85%), Positives = 69/71 (97%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFR+Q+L SG+GPSRIDIVTGWGRRSKV GSSLVRQ+V++LL+IF Sbjct: 779 MSDGTAVTALSRTLAWFRQQLLLSGVGPSRIDIVTGWGRRSKVTGSSLVRQAVQDLLSIF 838 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 839 SFPFFTENGNS 849 >ref|XP_004138146.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Cucumis sativus] Length = 874 Score = 128 bits (322), Expect = 7e-28 Identities = 61/71 (85%), Positives = 69/71 (97%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFR+Q+L SG+GPSRIDIVTGWGRRSKV GSSLVRQ+V++LL+IF Sbjct: 779 MSDGTAVTALSRTLAWFRQQLLLSGVGPSRIDIVTGWGRRSKVTGSSLVRQAVQDLLSIF 838 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 839 SFPFFTENGNS 849 >ref|XP_007210374.1| hypothetical protein PRUPE_ppa001256mg [Prunus persica] gi|462406109|gb|EMJ11573.1| hypothetical protein PRUPE_ppa001256mg [Prunus persica] Length = 870 Score = 127 bits (319), Expect = 2e-27 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFR+QML SGI PSRIDIVTGWGRRS+V GSSLVRQ+V+ELLN+F Sbjct: 775 MSDGTAVTALSRTLAWFRQQMLISGICPSRIDIVTGWGRRSRVTGSSLVRQAVEELLNMF 834 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 835 SFPFFTENGNS 845 >ref|XP_002511505.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550620|gb|EEF52107.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 876 Score = 127 bits (319), Expect = 2e-27 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFR+QML SGI PSRIDIVTGWGRRS+V GSS+VRQ+V+ELL+IF Sbjct: 781 MSDGTAVTALSRTLAWFRQQMLVSGISPSRIDIVTGWGRRSRVTGSSMVRQAVQELLHIF 840 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 841 SFPFFTENGNS 851 >ref|XP_007037187.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508774432|gb|EOY21688.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 859 Score = 127 bits (318), Expect = 2e-27 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFR+QML SGI PSRIDIVTGWGRRS+V GSSLVRQ+V++LL+IF Sbjct: 764 MSDGTAVTALSRTLAWFRQQMLVSGISPSRIDIVTGWGRRSRVTGSSLVRQAVQDLLSIF 823 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 824 SFPFFTENGNS 834 >ref|XP_004513211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Cicer arietinum] Length = 879 Score = 127 bits (318), Expect = 2e-27 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFRRQML SG+ P+RIDIVTGWGRRS+V GSSLVRQSV ELL +F Sbjct: 784 MSDGTAVTALSRTLAWFRRQMLISGVSPNRIDIVTGWGRRSRVTGSSLVRQSVHELLRLF 843 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 844 SFPFFTENGNS 854 >ref|XP_006476670.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750-like [Citrus sinensis] Length = 856 Score = 125 bits (314), Expect = 6e-27 Identities = 59/71 (83%), Positives = 68/71 (95%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAV ALSRTLAWFR+QML SG+GPSRIDIVTGWGRRS+V G+SLVRQ+V+ELL++F Sbjct: 761 MSDGTAVIALSRTLAWFRKQMLISGVGPSRIDIVTGWGRRSRVTGTSLVRQAVQELLHMF 820 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 821 SFPFFTENGNS 831 >ref|XP_006439668.1| hypothetical protein CICLE_v10018829mg [Citrus clementina] gi|557541930|gb|ESR52908.1| hypothetical protein CICLE_v10018829mg [Citrus clementina] Length = 856 Score = 125 bits (314), Expect = 6e-27 Identities = 59/71 (83%), Positives = 68/71 (95%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAV ALSRTLAWFR+QML SG+GPSRIDIVTGWGRRS+V G+SLVRQ+V+ELL++F Sbjct: 761 MSDGTAVIALSRTLAWFRKQMLMSGVGPSRIDIVTGWGRRSRVTGTSLVRQAVQELLHMF 820 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 821 SFPFFTENGNS 831 >ref|XP_006390391.1| hypothetical protein EUTSA_v10018113mg [Eutrema salsugineum] gi|557086825|gb|ESQ27677.1| hypothetical protein EUTSA_v10018113mg [Eutrema salsugineum] Length = 859 Score = 125 bits (313), Expect = 8e-27 Identities = 60/71 (84%), Positives = 67/71 (94%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MS+GTAVTALSRTLAWFR+QML SG PSRIDIVTGWGRRS+V G+S+VRQ+V+ELLNIF Sbjct: 764 MSEGTAVTALSRTLAWFRKQMLVSGECPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIF 823 Query: 181 NFPFFTENGNS 213 NFPFFTENGNS Sbjct: 824 NFPFFTENGNS 834 >ref|XP_002321537.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222868533|gb|EEF05664.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 834 Score = 125 bits (313), Expect = 8e-27 Identities = 60/71 (84%), Positives = 68/71 (95%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MS+GTAVTALSRTLAWFRRQML SG+ PSRIDIVTGWGRRS+V GSSLVRQ+V+ELL+IF Sbjct: 739 MSEGTAVTALSRTLAWFRRQMLVSGVIPSRIDIVTGWGRRSRVTGSSLVRQAVQELLHIF 798 Query: 181 NFPFFTENGNS 213 +FPFFTENGN+ Sbjct: 799 SFPFFTENGNT 809 >gb|EXC34220.1| hypothetical protein L484_010090 [Morus notabilis] Length = 872 Score = 124 bits (311), Expect = 1e-26 Identities = 60/71 (84%), Positives = 67/71 (94%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWFRR+ML SGI PSRIDIVTGWGRRS+V G+SLVRQ+V+ELL +F Sbjct: 777 MSDGTAVTALSRTLAWFRREMLISGICPSRIDIVTGWGRRSRVTGASLVRQAVQELLRMF 836 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 837 SFPFFTENGNS 847 >ref|XP_006300690.1| hypothetical protein CARUB_v10019733mg [Capsella rubella] gi|482569400|gb|EOA33588.1| hypothetical protein CARUB_v10019733mg [Capsella rubella] Length = 853 Score = 122 bits (307), Expect = 4e-26 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MS+GTAV ALSRTLAWFR+QML SG PSRIDIVTGWGRRS+V G+S+VRQ+V+ELLNIF Sbjct: 758 MSEGTAVIALSRTLAWFRKQMLVSGDCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIF 817 Query: 181 NFPFFTENGNS 213 NFPFFTENGNS Sbjct: 818 NFPFFTENGNS 828 >ref|XP_006300689.1| hypothetical protein CARUB_v10019733mg [Capsella rubella] gi|482569399|gb|EOA33587.1| hypothetical protein CARUB_v10019733mg [Capsella rubella] Length = 945 Score = 122 bits (307), Expect = 4e-26 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MS+GTAV ALSRTLAWFR+QML SG PSRIDIVTGWGRRS+V G+S+VRQ+V+ELLNIF Sbjct: 850 MSEGTAVIALSRTLAWFRKQMLVSGDCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIF 909 Query: 181 NFPFFTENGNS 213 NFPFFTENGNS Sbjct: 910 NFPFFTENGNS 920 >ref|NP_177613.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207514|sp|Q9SSF9.1|PP123_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g74750 gi|5882748|gb|AAD55301.1|AC008263_32 Contains 2 PF|01535 DUF domains [Arabidopsis thaliana] gi|332197508|gb|AEE35629.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 855 Score = 122 bits (307), Expect = 4e-26 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MS+GTAV ALSRTLAWFR+QML SG PSRIDIVTGWGRRS+V G+S+VRQ+V+ELLNIF Sbjct: 760 MSEGTAVIALSRTLAWFRKQMLVSGDCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIF 819 Query: 181 NFPFFTENGNS 213 NFPFFTENGNS Sbjct: 820 NFPFFTENGNS 830 >ref|XP_002266698.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74750 [Vitis vinifera] Length = 875 Score = 122 bits (306), Expect = 5e-26 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLAWF R+ML SG PSRIDIVTGWGRRS+V G+SLVRQ+V+ELL+IF Sbjct: 780 MSDGTAVTALSRTLAWFHREMLVSGTVPSRIDIVTGWGRRSRVTGASLVRQAVQELLHIF 839 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 840 SFPFFTENGNS 850 >ref|XP_007157658.1| hypothetical protein PHAVU_002G087700g [Phaseolus vulgaris] gi|561031073|gb|ESW29652.1| hypothetical protein PHAVU_002G087700g [Phaseolus vulgaris] Length = 881 Score = 122 bits (305), Expect = 7e-26 Identities = 58/71 (81%), Positives = 67/71 (94%) Frame = +1 Query: 1 MSDGTAVTALSRTLAWFRRQMLASGIGPSRIDIVTGWGRRSKVMGSSLVRQSVKELLNIF 180 MSDGTAVTALSRTLA FR++ML SG+GP+RIDI+TGWGRRS+V GSSLVRQ+V ELLN+F Sbjct: 786 MSDGTAVTALSRTLASFRQKMLTSGVGPNRIDIITGWGRRSRVTGSSLVRQTVHELLNLF 845 Query: 181 NFPFFTENGNS 213 +FPFFTENGNS Sbjct: 846 SFPFFTENGNS 856