BLASTX nr result
ID: Akebia24_contig00047715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00047715 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007221295.1| hypothetical protein PRUPE_ppa024499mg, part... 45 4e-06 >ref|XP_007221295.1| hypothetical protein PRUPE_ppa024499mg, partial [Prunus persica] gi|462417929|gb|EMJ22494.1| hypothetical protein PRUPE_ppa024499mg, partial [Prunus persica] Length = 1364 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 23/42 (54%), Positives = 28/42 (66%) Frame = -3 Query: 182 LRPLIGIFVVVYLDDILANTSDKEMHEQHKCGLFGILQQETL 57 LRP IG F+VVY DDIL + KE H QH +F +L+QE L Sbjct: 716 LRPYIGKFLVVYFDDILIYSHSKEDHLQHLRTIFHMLRQEKL 757 Score = 31.6 bits (70), Expect(2) = 4e-06 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -1 Query: 277 RSRYHQIRMRS*DKWKMAIQCTKYLHE 197 RS YHQIR+R D+WK A + L+E Sbjct: 667 RSGYHQIRIREGDEWKTAFKTPDGLYE 693