BLASTX nr result
ID: Akebia24_contig00047552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00047552 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67410.1| hypothetical protein VITISV_025621 [Vitis vinifera] 72 8e-11 >emb|CAN67410.1| hypothetical protein VITISV_025621 [Vitis vinifera] Length = 735 Score = 72.0 bits (175), Expect = 8e-11 Identities = 49/112 (43%), Positives = 65/112 (58%), Gaps = 14/112 (12%) Frame = -1 Query: 294 SLTMSSDAVTSYLIRRNSMVSSTIPSEHNIPLKKHRSSIL-LTNGVK-----------AS 151 S ++S +S L RRNS+ ++ IP++ +P K H SS NGV+ +S Sbjct: 556 SASISHPPPSSNLRRRNSIGTAAIPTKLTLPSKAHYSSSFPRPNGVRVSSSTSSSSPQSS 615 Query: 150 FPTFDLELFSLKSPSYTSLKDLPPASPVHQSPTEIGI--QSIYEIPIKNQLV 1 FP D EL SLKS +YTSLKDL P++ QSPT G S YEI I+N+LV Sbjct: 616 FPNVDFELISLKSLAYTSLKDLLPSTSAAQSPTAAGTGSGSCYEISIRNRLV 667