BLASTX nr result
ID: Akebia24_contig00046754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00046754 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853854.1| hypothetical protein AMTR_s00036p00097210 [A... 63 4e-08 >ref|XP_006853854.1| hypothetical protein AMTR_s00036p00097210 [Amborella trichopoda] gi|548857522|gb|ERN15321.1| hypothetical protein AMTR_s00036p00097210 [Amborella trichopoda] Length = 1236 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 109 MARGSRIKEKLRWSNLYTFSCIHQNILESEGSHSLRGPGFS 231 M R R + KLRWSNLY+FSC+ ++LESEG HSL+GPGFS Sbjct: 1 MPRAGRRRGKLRWSNLYSFSCVRPSVLESEGPHSLQGPGFS 41