BLASTX nr result
ID: Akebia24_contig00046638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00046638 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007199272.1| hypothetical protein PRUPE_ppa022734mg [Prun... 111 1e-22 gb|EXC75282.1| hypothetical protein L484_000391 [Morus notabilis] 108 8e-22 ref|XP_007028790.1| Pentatricopeptide repeat superfamily protein... 107 1e-21 ref|XP_004290462.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|XP_002268148.2| PREDICTED: uncharacterized protein LOC100250... 107 1e-21 dbj|BAJ53258.1| JMS10C05.1 [Jatropha curcas] 107 1e-21 emb|CBI36868.3| unnamed protein product [Vitis vinifera] 107 1e-21 ref|XP_006351408.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_004249755.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 dbj|BAK03903.1| predicted protein [Hordeum vulgare subsp. vulgare] 107 2e-21 emb|CBI28140.3| unnamed protein product [Vitis vinifera] 107 2e-21 ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_007020191.1| Tetratricopeptide repeat (TPR)-like superfam... 106 3e-21 ref|XP_006473158.1| PREDICTED: pentatricopeptide repeat-containi... 106 4e-21 ref|XP_006395137.1| hypothetical protein EUTSA_v10003805mg [Eutr... 106 4e-21 ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily p... 105 5e-21 ref|XP_006653508.1| PREDICTED: pentatricopeptide repeat-containi... 105 6e-21 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 105 6e-21 ref|XP_002265412.1| PREDICTED: pentatricopeptide repeat-containi... 105 6e-21 ref|XP_006434562.1| hypothetical protein CICLE_v10003512mg [Citr... 105 8e-21 >ref|XP_007199272.1| hypothetical protein PRUPE_ppa022734mg [Prunus persica] gi|462394672|gb|EMJ00471.1| hypothetical protein PRUPE_ppa022734mg [Prunus persica] Length = 576 Score = 111 bits (277), Expect = 1e-22 Identities = 48/67 (71%), Positives = 57/67 (85%) Frame = +3 Query: 6 EKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGGC 185 EKLAVAFGLISTS PI++IKNLRIC+DCH +K++S++Y REIIVRD RFHRF GC Sbjct: 510 EKLAVAFGLISTSEGTPIQVIKNLRICDDCHAVIKLISKIYNREIIVRDRARFHRFKEGC 569 Query: 186 CSCKDYW 206 CSC+DYW Sbjct: 570 CSCRDYW 576 >gb|EXC75282.1| hypothetical protein L484_000391 [Morus notabilis] Length = 581 Score = 108 bits (270), Expect = 8e-22 Identities = 49/68 (72%), Positives = 56/68 (82%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLAVAFGLISTS PI++IKNLRICEDCH +K++S ++ REIIVRD RFHRF G Sbjct: 514 SEKLAVAFGLISTSEGAPIQVIKNLRICEDCHVVIKLISTIFSREIIVRDRARFHRFKEG 573 Query: 183 CCSCKDYW 206 CSCKDYW Sbjct: 574 SCSCKDYW 581 >ref|XP_007028790.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508717395|gb|EOY09292.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 502 Score = 107 bits (268), Expect = 1e-21 Identities = 45/68 (66%), Positives = 55/68 (80%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SE+LA+A+GL+ T AP PIRI+KNLRIC DCHE K++S++Y REIIVRD RFH+F G Sbjct: 435 SERLAIAYGLLKTKAPAPIRIVKNLRICSDCHEVTKIISKIYGREIIVRDRVRFHKFVNG 494 Query: 183 CCSCKDYW 206 CSC DYW Sbjct: 495 TCSCIDYW 502 >ref|XP_004290462.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Fragaria vesca subsp. vesca] Length = 576 Score = 107 bits (268), Expect = 1e-21 Identities = 49/67 (73%), Positives = 56/67 (83%) Frame = +3 Query: 6 EKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGGC 185 EKLAVAFGLISTS PI++IKNLRIC+DCH +K+VS+VY REIIVRD RFHRF G Sbjct: 510 EKLAVAFGLISTSEGTPIQVIKNLRICDDCHVVMKLVSKVYNREIIVRDRARFHRFQDGF 569 Query: 186 CSCKDYW 206 CSC+DYW Sbjct: 570 CSCRDYW 576 >ref|XP_002268148.2| PREDICTED: uncharacterized protein LOC100250295 [Vitis vinifera] Length = 1130 Score = 107 bits (268), Expect = 1e-21 Identities = 45/68 (66%), Positives = 56/68 (82%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLA+A+G + TS PIRI+KNLRIC DCH +K++S+V++REIIVRDC RFH FT G Sbjct: 505 SEKLALAYGFLKTSPGTPIRIVKNLRICRDCHVAIKMISKVFDREIIVRDCNRFHHFTQG 564 Query: 183 CCSCKDYW 206 CSC+DYW Sbjct: 565 LCSCRDYW 572 >dbj|BAJ53258.1| JMS10C05.1 [Jatropha curcas] Length = 563 Score = 107 bits (268), Expect = 1e-21 Identities = 44/68 (64%), Positives = 56/68 (82%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SE+LA+A+GL+ T AP IRI+KNLR+C DCHE K++S++Y+REIIVRD RFH+F G Sbjct: 496 SERLAIAYGLMKTKAPATIRIVKNLRVCGDCHEVTKIISKIYDREIIVRDRVRFHKFVNG 555 Query: 183 CCSCKDYW 206 CSCKDYW Sbjct: 556 TCSCKDYW 563 >emb|CBI36868.3| unnamed protein product [Vitis vinifera] Length = 541 Score = 107 bits (268), Expect = 1e-21 Identities = 45/68 (66%), Positives = 56/68 (82%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLA+A+G + TS PIRI+KNLRIC DCH +K++S+V++REIIVRDC RFH FT G Sbjct: 474 SEKLALAYGFLKTSPGTPIRIVKNLRICRDCHVAIKMISKVFDREIIVRDCNRFHHFTQG 533 Query: 183 CCSCKDYW 206 CSC+DYW Sbjct: 534 LCSCRDYW 541 >ref|XP_006351408.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Solanum tuberosum] Length = 401 Score = 107 bits (267), Expect = 2e-21 Identities = 44/68 (64%), Positives = 54/68 (79%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SE+LA+AFGL+ T AP IRI+KNLR+C DCHE K++S +Y REIIVRD RFHRF G Sbjct: 334 SERLAIAFGLLKTKAPTVIRIVKNLRVCRDCHEVTKIISRIYNREIIVRDRVRFHRFVNG 393 Query: 183 CCSCKDYW 206 CSC+D+W Sbjct: 394 ACSCRDFW 401 >ref|XP_004249755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Solanum lycopersicum] Length = 593 Score = 107 bits (267), Expect = 2e-21 Identities = 44/68 (64%), Positives = 54/68 (79%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SE+LA+AFGL+ T AP IRI+KNLR+C DCHE K++S +Y REIIVRD RFHRF G Sbjct: 526 SERLAIAFGLLKTKAPAVIRIVKNLRVCRDCHEVTKIISRIYNREIIVRDRVRFHRFVNG 585 Query: 183 CCSCKDYW 206 CSC+D+W Sbjct: 586 ACSCRDFW 593 >dbj|BAK03903.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 598 Score = 107 bits (266), Expect = 2e-21 Identities = 48/68 (70%), Positives = 55/68 (80%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLA+AF LIST MPIRI+KNLR+C+DCH K++S+VY REIIVRD TRFH F G Sbjct: 531 SEKLAIAFALISTEDYMPIRIVKNLRVCQDCHHVTKLISKVYGREIIVRDRTRFHLFKDG 590 Query: 183 CCSCKDYW 206 CSCKDYW Sbjct: 591 TCSCKDYW 598 >emb|CBI28140.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 107 bits (266), Expect = 2e-21 Identities = 45/68 (66%), Positives = 55/68 (80%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLA+AFGL+ST+ PIR++KNLR+C DCH +K +SEVY REIIVRD RFH FT G Sbjct: 513 SEKLAIAFGLLSTTPGTPIRVVKNLRVCSDCHSAMKFISEVYNREIIVRDRNRFHHFTKG 572 Query: 183 CCSCKDYW 206 CSC+D+W Sbjct: 573 SCSCRDFW 580 >ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 711 Score = 107 bits (266), Expect = 2e-21 Identities = 45/68 (66%), Positives = 55/68 (80%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLA+AFGL+ST+ PIR++KNLR+C DCH +K +SEVY REIIVRD RFH FT G Sbjct: 644 SEKLAIAFGLLSTTPGTPIRVVKNLRVCSDCHSAMKFISEVYNREIIVRDRNRFHHFTKG 703 Query: 183 CCSCKDYW 206 CSC+D+W Sbjct: 704 SCSCRDFW 711 >ref|XP_007020191.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508725519|gb|EOY17416.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 574 Score = 106 bits (265), Expect = 3e-21 Identities = 48/68 (70%), Positives = 56/68 (82%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLAVAFGLIST+ PI++IKNLRIC DCH +K +S++YEREIIVRD RFHRF G Sbjct: 507 SEKLAVAFGLISTNEGTPIQVIKNLRICGDCHVVIKHISKIYEREIIVRDRVRFHRFRDG 566 Query: 183 CCSCKDYW 206 CSC+DYW Sbjct: 567 SCSCRDYW 574 >ref|XP_006473158.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Citrus sinensis] Length = 582 Score = 106 bits (264), Expect = 4e-21 Identities = 47/68 (69%), Positives = 55/68 (80%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLAVAFGLISTS I++ KNLRIC DCH+ +K++++VY REIIVRD RFHRF G Sbjct: 515 SEKLAVAFGLISTSEATSIQVFKNLRICRDCHDVIKLIAKVYNREIIVRDRVRFHRFKDG 574 Query: 183 CCSCKDYW 206 CSCKDYW Sbjct: 575 ACSCKDYW 582 >ref|XP_006395137.1| hypothetical protein EUTSA_v10003805mg [Eutrema salsugineum] gi|557091776|gb|ESQ32423.1| hypothetical protein EUTSA_v10003805mg [Eutrema salsugineum] Length = 645 Score = 106 bits (264), Expect = 4e-21 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEK+AVAFGLISTS PIRI+KNLRICEDCH ++K++S+VY+R+I VRD RFH F G Sbjct: 578 SEKIAVAFGLISTSPAKPIRIVKNLRICEDCHSSIKLISKVYKRKITVRDRKRFHHFQDG 637 Query: 183 CCSCKDYW 206 CSC DYW Sbjct: 638 SCSCMDYW 645 >ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508717783|gb|EOY09680.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 626 Score = 105 bits (263), Expect = 5e-21 Identities = 45/68 (66%), Positives = 55/68 (80%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLA+AFG++ T A MPIRI+KNLR+CEDCH K++S+V+ERE+IVRD RFH F G Sbjct: 559 SEKLAIAFGIMRTKASMPIRIVKNLRVCEDCHTATKLISKVFERELIVRDRNRFHHFRHG 618 Query: 183 CCSCKDYW 206 CSC DYW Sbjct: 619 TCSCMDYW 626 >ref|XP_006653508.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like [Oryza brachyantha] Length = 939 Score = 105 bits (262), Expect = 6e-21 Identities = 45/68 (66%), Positives = 57/68 (83%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SE+LA+AFGLISTS+ P+RI KNLR+C DCHE K+VS+++EREI+VRD RFH F+GG Sbjct: 872 SERLAIAFGLISTSSGSPLRIAKNLRVCGDCHEFTKLVSKLFEREIVVRDANRFHHFSGG 931 Query: 183 CCSCKDYW 206 CSC D+W Sbjct: 932 SCSCGDFW 939 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 105 bits (262), Expect = 6e-21 Identities = 45/68 (66%), Positives = 54/68 (79%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLAVAFGL+ST PIR+IKNLR+C DCH +K +S+VY+REI++RD RFHRF G Sbjct: 930 SEKLAVAFGLLSTPPSTPIRVIKNLRVCGDCHNAMKYISKVYDREIVLRDANRFHRFKDG 989 Query: 183 CCSCKDYW 206 CSC DYW Sbjct: 990 ICSCGDYW 997 >ref|XP_002265412.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Vitis vinifera] Length = 573 Score = 105 bits (262), Expect = 6e-21 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLAVAFGLISTS PIR+ KNLRIC DCH +K++S++Y++EIIVRD RFHRF G Sbjct: 506 SEKLAVAFGLISTSEGTPIRVNKNLRICGDCHVVIKLISKIYDQEIIVRDRARFHRFKDG 565 Query: 183 CCSCKDYW 206 CSC+DYW Sbjct: 566 SCSCRDYW 573 >ref|XP_006434562.1| hypothetical protein CICLE_v10003512mg [Citrus clementina] gi|557536684|gb|ESR47802.1| hypothetical protein CICLE_v10003512mg [Citrus clementina] Length = 582 Score = 105 bits (261), Expect = 8e-21 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = +3 Query: 3 SEKLAVAFGLISTSAPMPIRIIKNLRICEDCHETLKVVSEVYEREIIVRDCTRFHRFTGG 182 SEKLAVAFGLIS S I++ KNLRIC DCH+ +K++S+VY REIIVRD RFHRF G Sbjct: 515 SEKLAVAFGLISISEATSIQVFKNLRICRDCHDVIKLISKVYNREIIVRDRVRFHRFKDG 574 Query: 183 CCSCKDYW 206 CSCKDYW Sbjct: 575 ACSCKDYW 582