BLASTX nr result
ID: Akebia24_contig00046613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00046613 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216700.1| hypothetical protein PRUPE_ppa026625mg, part... 57 2e-06 >ref|XP_007216700.1| hypothetical protein PRUPE_ppa026625mg, partial [Prunus persica] gi|462412850|gb|EMJ17899.1| hypothetical protein PRUPE_ppa026625mg, partial [Prunus persica] Length = 190 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/57 (42%), Positives = 40/57 (70%) Frame = -1 Query: 232 CRDEKVKLDLISKDSTEYMRTKNFSIMHLGLVVIGIKGLTRPGLGTKVLVTLYDERW 62 C D++V L+ +S+ + E +R ++ +H+G ++ GI GLTR +GTK LV +YD+RW Sbjct: 19 CIDKEVTLNPLSQPAIEQLRKSHYRQIHIGTIMTGIAGLTRAHVGTKALVCIYDDRW 75