BLASTX nr result
ID: Akebia24_contig00046505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00046505 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007215745.1| hypothetical protein PRUPE_ppa009213mg [Prun... 60 2e-07 >ref|XP_007215745.1| hypothetical protein PRUPE_ppa009213mg [Prunus persica] gi|462411895|gb|EMJ16944.1| hypothetical protein PRUPE_ppa009213mg [Prunus persica] Length = 302 Score = 60.5 bits (145), Expect = 2e-07 Identities = 37/70 (52%), Positives = 44/70 (62%), Gaps = 3/70 (4%) Frame = +1 Query: 40 SAVADSAQIWCRSYL-DEFKRAPSHESSASQQTDL--NGEGCSRETESMFSVETVEASLV 210 S DSA+ C DEF R+ SHESS S Q++ N +G S+ETESM S ET EA L+ Sbjct: 172 SGADDSAKPSCAGCCADEFNRSTSHESSLSHQSEAAANVDGESKETESMVSSETAEAELL 231 Query: 211 SRPEPEPIRK 240 RPEPE RK Sbjct: 232 FRPEPESARK 241