BLASTX nr result
ID: Akebia24_contig00046412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00046412 (981 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855641.1| hypothetical protein AMTR_s00044p00106410 [A... 68 6e-09 gb|EXC35135.1| hypothetical protein L484_021497 [Morus notabilis] 61 8e-07 ref|XP_006451852.1| hypothetical protein CICLE_v10007828mg [Citr... 59 2e-06 ref|XP_006451851.1| hypothetical protein CICLE_v10007828mg [Citr... 59 2e-06 gb|EYU43390.1| hypothetical protein MIMGU_mgv1a021937mg [Mimulus... 58 7e-06 ref|XP_007211858.1| hypothetical protein PRUPE_ppa004778mg [Prun... 58 7e-06 >ref|XP_006855641.1| hypothetical protein AMTR_s00044p00106410 [Amborella trichopoda] gi|548859428|gb|ERN17108.1| hypothetical protein AMTR_s00044p00106410 [Amborella trichopoda] Length = 653 Score = 67.8 bits (164), Expect = 6e-09 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = +3 Query: 585 MTGGSLGQRTSSYGSLQQHQQNSVVLLPIQTSPVIVRKPSKMLLSGSREKEKILHRICKI 764 MTGGSLG RT SYGSL + S L SP +RKPSKML+SGSREKE+ +H I KI Sbjct: 1 MTGGSLGLRTGSYGSLHDQSKISPGLPVPNNSPNFIRKPSKMLISGSREKERFIHWIFKI 60 >gb|EXC35135.1| hypothetical protein L484_021497 [Morus notabilis] Length = 733 Score = 60.8 bits (146), Expect = 8e-07 Identities = 40/88 (45%), Positives = 51/88 (57%), Gaps = 16/88 (18%) Frame = +3 Query: 546 EKGDEREIGFGGKMTGGSLGQRTSSYGSLQ---------------QHQQNSV-VLLPIQT 677 E+GD+ F G MTGGSLG RT SYGSLQ QHQQ +Q Sbjct: 10 EEGDD--FRFKGTMTGGSLGLRTGSYGSLQLQQHQQQQHQHQQQHQHQQQQKNGFWNVQP 67 Query: 678 SPVIVRKPSKMLLSGSREKEKILHRICK 761 +P+++RKPSK+LL SREKEK+ +C+ Sbjct: 68 TPILLRKPSKLLL--SREKEKLRPLLCR 93 >ref|XP_006451852.1| hypothetical protein CICLE_v10007828mg [Citrus clementina] gi|557555078|gb|ESR65092.1| hypothetical protein CICLE_v10007828mg [Citrus clementina] Length = 547 Score = 59.3 bits (142), Expect = 2e-06 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = +3 Query: 585 MTGGSLGQRTSSYGSLQQHQQNSVVLLPIQTSPVIVRKPS-KMLLSGSREKEK--ILHRI 755 MTGGSLGQRT+SYGSLQ N +V P S + RKPS KMLL+GSR++EK +L Sbjct: 1 MTGGSLGQRTASYGSLQLLNNNGIVGKP--ASSIFTRKPSPKMLLAGSRDREKQFLLLVF 58 Query: 756 CK 761 CK Sbjct: 59 CK 60 >ref|XP_006451851.1| hypothetical protein CICLE_v10007828mg [Citrus clementina] gi|568820493|ref|XP_006464750.1| PREDICTED: uncharacterized protein LOC102625940 isoform X1 [Citrus sinensis] gi|568820495|ref|XP_006464751.1| PREDICTED: uncharacterized protein LOC102625940 isoform X2 [Citrus sinensis] gi|557555077|gb|ESR65091.1| hypothetical protein CICLE_v10007828mg [Citrus clementina] Length = 586 Score = 59.3 bits (142), Expect = 2e-06 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = +3 Query: 585 MTGGSLGQRTSSYGSLQQHQQNSVVLLPIQTSPVIVRKPS-KMLLSGSREKEK--ILHRI 755 MTGGSLGQRT+SYGSLQ N +V P S + RKPS KMLL+GSR++EK +L Sbjct: 1 MTGGSLGQRTASYGSLQLLNNNGIVGKP--ASSIFTRKPSPKMLLAGSRDREKQFLLLVF 58 Query: 756 CK 761 CK Sbjct: 59 CK 60 >gb|EYU43390.1| hypothetical protein MIMGU_mgv1a021937mg [Mimulus guttatus] Length = 577 Score = 57.8 bits (138), Expect = 7e-06 Identities = 36/62 (58%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = +3 Query: 585 MTGGSLGQRTS-SYGSLQQHQQNSVVLLPIQTSPVIVRKPSKMLLSGSREKEKILHRICK 761 MT GSLG R+S SYGSLQ QN + LPIQT+P RKP KML +EK+K+ HRI K Sbjct: 1 MTTGSLGLRSSGSYGSLQP-IQNGSICLPIQTTPPFSRKPPKML----KEKDKLFHRIFK 55 Query: 762 IA 767 A Sbjct: 56 FA 57 >ref|XP_007211858.1| hypothetical protein PRUPE_ppa004778mg [Prunus persica] gi|462407723|gb|EMJ13057.1| hypothetical protein PRUPE_ppa004778mg [Prunus persica] Length = 492 Score = 57.8 bits (138), Expect = 7e-06 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = +3 Query: 585 MTGGSLGQRTSSYGSLQQHQQNSVVLLPIQTSPVIVRKPSKMLLSGSREKEKILHRICK 761 MTGGSLG RT SYGSLQQ Q +P + RK SK+LLS SREK+++L +C+ Sbjct: 1 MTGGSLGLRTGSYGSLQQLQLIQNGFSHNLPTPGLTRKSSKLLLSSSREKDRVLPFVCR 59