BLASTX nr result
ID: Akebia24_contig00045984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045984 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006376183.1| hypothetical protein POPTR_0013s10600g [Popu... 60 3e-07 >ref|XP_006376183.1| hypothetical protein POPTR_0013s10600g [Populus trichocarpa] gi|550325453|gb|ERP53980.1| hypothetical protein POPTR_0013s10600g [Populus trichocarpa] Length = 636 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 5/69 (7%) Frame = +2 Query: 95 TIHPQQP--TPES-ESHQVMRTLCAQGQLQEALSLLYAFN--NNNSQTYATLLHACARHG 259 +IHPQ P TPE+ + +R L +G ++EALS Y+ N + QTYATL HACARHG Sbjct: 19 SIHPQLPNSTPEATDLFNKVRVLSTRGNIKEALSFFYSTPQLNQSQQTYATLFHACARHG 78 Query: 260 SLAEGRAPH 286 +L +G+ H Sbjct: 79 NLKQGQYLH 87