BLASTX nr result
ID: Akebia24_contig00045750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045750 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320024.1| transducin-related family protein [Populus t... 83 5e-14 ref|XP_003634345.1| PREDICTED: cirhin-like [Vitis vinifera] 82 1e-13 emb|CBI19382.3| unnamed protein product [Vitis vinifera] 82 1e-13 ref|XP_002285401.1| PREDICTED: cirhin-like isoform 2 [Vitis vini... 82 1e-13 ref|XP_002285395.1| PREDICTED: cirhin-like isoform 1 [Vitis vini... 82 1e-13 ref|XP_002301144.1| transducin-related family protein [Populus t... 79 9e-13 ref|XP_006650549.1| PREDICTED: cirhin-like [Oryza brachyantha] 78 1e-12 ref|XP_006472314.1| PREDICTED: cirhin-like [Citrus sinensis] 78 1e-12 ref|XP_006433650.1| hypothetical protein CICLE_v10000301mg [Citr... 78 1e-12 ref|NP_001051185.2| Os03g0735100 [Oryza sativa Japonica Group] g... 77 2e-12 gb|EEC76134.1| hypothetical protein OsI_13420 [Oryza sativa Indi... 77 2e-12 dbj|BAH01145.1| unnamed protein product [Oryza sativa Japonica G... 77 2e-12 gb|AAT78790.1| expressed protein [Oryza sativa Japonica Group] g... 77 2e-12 ref|XP_007032264.1| Transducin family protein / WD-40 repeat fam... 77 3e-12 ref|XP_007227004.1| hypothetical protein PRUPE_ppa001485mg [Prun... 75 1e-11 ref|XP_004238081.1| PREDICTED: U3 small nucleolar RNA-associated... 74 3e-11 ref|XP_002466503.1| hypothetical protein SORBIDRAFT_01g008930 [S... 73 4e-11 ref|XP_006356851.1| PREDICTED: U3 small nucleolar RNA-associated... 72 6e-11 ref|XP_006857125.1| hypothetical protein AMTR_s00065p00140150 [A... 71 1e-10 gb|EPS65026.1| hypothetical protein M569_09751, partial [Genlise... 71 2e-10 >ref|XP_002320024.1| transducin-related family protein [Populus trichocarpa] gi|222860797|gb|EEE98339.1| transducin-related family protein [Populus trichocarpa] Length = 818 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = +1 Query: 13 QPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDA-PVHRHIFGT 177 QP+ K R+NF+ F DPVLF+GHLSENS+L+MDK W +V+ FDA PVHRHIFGT Sbjct: 763 QPETKLRKNFEILAFRDPVLFIGHLSENSILIMDKPWMDVVKTFDAQPVHRHIFGT 818 >ref|XP_003634345.1| PREDICTED: cirhin-like [Vitis vinifera] Length = 814 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = +1 Query: 1 DSTTQPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 +S K R+NF+F F DPVLFVGHLS+NS+L++DK W +VR F APVHRHIFGT Sbjct: 756 ESGLDTKLNDRKNFEFCAFRDPVLFVGHLSKNSLLIIDKPWADVVRTFSAPVHRHIFGT 814 >emb|CBI19382.3| unnamed protein product [Vitis vinifera] Length = 740 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = +1 Query: 1 DSTTQPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 +S K R+NF+F F DPVLFVGHLS+NS+L++DK W +VR F APVHRHIFGT Sbjct: 682 ESGLDTKLNDRKNFEFCAFRDPVLFVGHLSKNSLLIIDKPWADVVRTFSAPVHRHIFGT 740 >ref|XP_002285401.1| PREDICTED: cirhin-like isoform 2 [Vitis vinifera] Length = 821 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = +1 Query: 1 DSTTQPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 +S K R+NF+F F DPVLFVGHLS+NS+L++DK W +VR F APVHRHIFGT Sbjct: 763 ESGLDTKLNDRKNFEFCAFRDPVLFVGHLSKNSLLIIDKPWADVVRTFSAPVHRHIFGT 821 >ref|XP_002285395.1| PREDICTED: cirhin-like isoform 1 [Vitis vinifera] Length = 828 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = +1 Query: 1 DSTTQPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 +S K R+NF+F F DPVLFVGHLS+NS+L++DK W +VR F APVHRHIFGT Sbjct: 770 ESGLDTKLNDRKNFEFCAFRDPVLFVGHLSKNSLLIIDKPWADVVRTFSAPVHRHIFGT 828 >ref|XP_002301144.1| transducin-related family protein [Populus trichocarpa] gi|222842870|gb|EEE80417.1| transducin-related family protein [Populus trichocarpa] Length = 819 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/56 (62%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +1 Query: 13 QPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDA-PVHRHIFGT 177 QP+ K R+NF+ F DPVLF HLSENS+L++DK W +V+ FDA PVHRHIFGT Sbjct: 764 QPEAKHRKNFELLAFRDPVLFFSHLSENSILILDKPWMDVVKTFDAQPVHRHIFGT 819 >ref|XP_006650549.1| PREDICTED: cirhin-like [Oryza brachyantha] Length = 696 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = +1 Query: 13 QPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 +P+ + R NFDF F DPVLFVGHL +NSVL+++K W +V F APVHRHI+GT Sbjct: 642 EPRQEIRNNFDFFAFKDPVLFVGHLLDNSVLMVEKRWMDVVEGFGAPVHRHIYGT 696 >ref|XP_006472314.1| PREDICTED: cirhin-like [Citrus sinensis] Length = 817 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = +1 Query: 7 TTQPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 T K R+NF+F F DPVLF+GHLS++S+L++DK W +V+ FDAPVHRHI+GT Sbjct: 761 TESNKLHGRKNFEFFAFRDPVLFIGHLSKSSMLIIDKPWLEVVKTFDAPVHRHIYGT 817 >ref|XP_006433650.1| hypothetical protein CICLE_v10000301mg [Citrus clementina] gi|557535772|gb|ESR46890.1| hypothetical protein CICLE_v10000301mg [Citrus clementina] Length = 817 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = +1 Query: 7 TTQPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 T K R+NF+F F DPVLF+GHLS++S+L++DK W +V+ FDAPVHRHI+GT Sbjct: 761 TESNKLHGRKNFEFFAFRDPVLFIGHLSKSSMLIIDKPWLEVVKTFDAPVHRHIYGT 817 >ref|NP_001051185.2| Os03g0735100 [Oryza sativa Japonica Group] gi|255674876|dbj|BAF13099.2| Os03g0735100 [Oryza sativa Japonica Group] Length = 444 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +1 Query: 31 RENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 R NFDF F DPVLFVGHLS+NSVL+++K W +V F APVHRHI+GT Sbjct: 396 RNNFDFFAFKDPVLFVGHLSDNSVLMVEKRWMDVVEGFGAPVHRHIYGT 444 >gb|EEC76134.1| hypothetical protein OsI_13420 [Oryza sativa Indica Group] Length = 807 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +1 Query: 31 RENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 R NFDF F DPVLFVGHLS+NSVL+++K W +V F APVHRHI+GT Sbjct: 759 RNNFDFFAFKDPVLFVGHLSDNSVLMVEKRWMDVVEGFGAPVHRHIYGT 807 >dbj|BAH01145.1| unnamed protein product [Oryza sativa Japonica Group] gi|222625747|gb|EEE59879.1| hypothetical protein OsJ_12479 [Oryza sativa Japonica Group] Length = 807 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +1 Query: 31 RENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 R NFDF F DPVLFVGHLS+NSVL+++K W +V F APVHRHI+GT Sbjct: 759 RNNFDFFAFKDPVLFVGHLSDNSVLMVEKRWMDVVEGFGAPVHRHIYGT 807 >gb|AAT78790.1| expressed protein [Oryza sativa Japonica Group] gi|108710937|gb|ABF98732.1| retrotransposon, putative, centromere-specific, expressed [Oryza sativa Japonica Group] Length = 982 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +1 Query: 31 RENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 R NFDF F DPVLFVGHLS+NSVL+++K W +V F APVHRHI+GT Sbjct: 934 RNNFDFFAFKDPVLFVGHLSDNSVLMVEKRWMDVVEGFGAPVHRHIYGT 982 >ref|XP_007032264.1| Transducin family protein / WD-40 repeat family protein, putative isoform 1 [Theobroma cacao] gi|508711293|gb|EOY03190.1| Transducin family protein / WD-40 repeat family protein, putative isoform 1 [Theobroma cacao] Length = 829 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 2/61 (3%) Frame = +1 Query: 1 DSTTQPKHKQRE-NFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDA-PVHRHIFG 174 DS T+ KH R+ NFD F DPVLF+GHLS++S+L++DK W +V+ FDA PV RHIFG Sbjct: 769 DSQTESKHTSRKSNFDLIVFRDPVLFIGHLSKHSILIVDKPWMEVVKTFDAPPVQRHIFG 828 Query: 175 T 177 T Sbjct: 829 T 829 >ref|XP_007227004.1| hypothetical protein PRUPE_ppa001485mg [Prunus persica] gi|462423940|gb|EMJ28203.1| hypothetical protein PRUPE_ppa001485mg [Prunus persica] Length = 815 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 1/60 (1%) Frame = +1 Query: 1 DSTTQPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFD-APVHRHIFGT 177 DS + K R+NF+F F++P LFVGHLS++S+L++DK W +V++FD APVHRH+FGT Sbjct: 756 DSQAKSKLIARKNFEFYAFTNPALFVGHLSKSSILMIDKPWMEVVKSFDTAPVHRHVFGT 815 >ref|XP_004238081.1| PREDICTED: U3 small nucleolar RNA-associated protein 4-like [Solanum lycopersicum] Length = 809 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/59 (57%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = +1 Query: 4 STTQPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFD-APVHRHIFGT 177 S + K R+NF+F F DPVLFVGHLS+ S L++DK W +V++FD PVHRHIFGT Sbjct: 751 SDLETKLNGRKNFEFHAFRDPVLFVGHLSKTSTLIIDKPWIQVVKSFDTTPVHRHIFGT 809 >ref|XP_002466503.1| hypothetical protein SORBIDRAFT_01g008930 [Sorghum bicolor] gi|241920357|gb|EER93501.1| hypothetical protein SORBIDRAFT_01g008930 [Sorghum bicolor] Length = 721 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/55 (52%), Positives = 42/55 (76%) Frame = +1 Query: 13 QPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 + K ++R NF+F F +PVLFVGHL ++S+L+++K W +V F APVHRHI+GT Sbjct: 667 ESKQEKRNNFNFFAFKEPVLFVGHLLDSSILIVEKRWMDVVEGFSAPVHRHIYGT 721 >ref|XP_006356851.1| PREDICTED: U3 small nucleolar RNA-associated protein 4-like [Solanum tuberosum] Length = 809 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +1 Query: 13 QPKHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFD-APVHRHIFGT 177 + K R+NF+F F DPVLFVGHLS+ S L++DK W +V++FD PVHRH+FGT Sbjct: 754 ETKLNGRKNFEFHAFRDPVLFVGHLSKTSTLIIDKPWIQVVKSFDTTPVHRHVFGT 809 >ref|XP_006857125.1| hypothetical protein AMTR_s00065p00140150 [Amborella trichopoda] gi|548861208|gb|ERN18592.1| hypothetical protein AMTR_s00065p00140150 [Amborella trichopoda] Length = 830 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/53 (56%), Positives = 42/53 (79%) Frame = +1 Query: 19 KHKQRENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFDAPVHRHIFGT 177 +++ +ENF F F DPV FVG++SE +VLV+DK W +V+ F+APVHRHI+GT Sbjct: 778 RNRGKENFAFKSFVDPVHFVGYVSEGNVLVIDKPWLEVVQTFEAPVHRHIYGT 830 >gb|EPS65026.1| hypothetical protein M569_09751, partial [Genlisea aurea] Length = 802 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = +1 Query: 31 RENFDFSCFSDPVLFVGHLSENSVLVMDKSWRAIVRAFD-APVHRHIFGT 177 R+NF+F F +PVLF GHLSENSVL++D+ W+ ++ +F+ PVHRHIFGT Sbjct: 753 RKNFEFYPFKEPVLFAGHLSENSVLIVDRPWKTVIDSFEFQPVHRHIFGT 802