BLASTX nr result
ID: Akebia24_contig00045697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045697 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40500.3| unnamed protein product [Vitis vinifera] 80 4e-13 ref|XP_002276948.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 emb|CAN82500.1| hypothetical protein VITISV_004914 [Vitis vinifera] 80 4e-13 ref|XP_007219296.1| hypothetical protein PRUPE_ppa018729mg [Prun... 77 3e-12 ref|XP_007135239.1| hypothetical protein PHAVU_010G112400g [Phas... 74 2e-11 ref|XP_003529895.2| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_003548424.2| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_004516409.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_007051582.1| Pentatricopeptide repeat-containing protein,... 72 6e-11 ref|XP_006491254.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_006444871.1| hypothetical protein CICLE_v10023767mg [Citr... 72 8e-11 ref|XP_002320193.2| hypothetical protein POPTR_0014s09270g [Popu... 72 1e-10 ref|XP_004231209.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_004308315.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_002523370.1| pentatricopeptide repeat-containing protein,... 67 2e-09 gb|EYU32225.1| hypothetical protein MIMGU_mgv1a001396mg [Mimulus... 66 6e-09 gb|EXB41949.1| hypothetical protein L484_002200 [Morus notabilis] 59 9e-07 ref|XP_003635166.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 57 2e-06 ref|XP_007210330.1| hypothetical protein PRUPE_ppa002054mg [Prun... 56 5e-06 ref|XP_006842799.1| hypothetical protein AMTR_s00081p00019740 [A... 56 6e-06 >emb|CBI40500.3| unnamed protein product [Vitis vinifera] Length = 1133 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/76 (50%), Positives = 48/76 (63%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 +VF S+ V L+ C + D WLG+ IH LIK GFD D L+CALM+FY WG+ A+ Sbjct: 519 VVFDSEVYSVALKTCTRVMDIWLGMEIHGCLIKRGFDLDVYLRCALMNFYGRCWGLEKAN 578 Query: 187 QVFVEMPLRTVSLWNK 234 QVF EMP LWN+ Sbjct: 579 QVFHEMPNPEALLWNE 594 >ref|XP_002276948.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Vitis vinifera] Length = 913 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/76 (50%), Positives = 48/76 (63%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 +VF S+ V L+ C + D WLG+ IH LIK GFD D L+CALM+FY WG+ A+ Sbjct: 129 VVFDSEVYSVALKTCTRVMDIWLGMEIHGCLIKRGFDLDVYLRCALMNFYGRCWGLEKAN 188 Query: 187 QVFVEMPLRTVSLWNK 234 QVF EMP LWN+ Sbjct: 189 QVFHEMPNPEALLWNE 204 >emb|CAN82500.1| hypothetical protein VITISV_004914 [Vitis vinifera] Length = 1408 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/76 (50%), Positives = 48/76 (63%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 +VF S+ V L+ C + D WLG+ IH LIK GFD D L+CALM+FY WG+ A+ Sbjct: 670 VVFDSEVYSVALKTCTRVMDIWLGMEIHGCLIKRGFDLDVYLRCALMNFYGRCWGLEKAN 729 Query: 187 QVFVEMPLRTVSLWNK 234 QVF EMP LWN+ Sbjct: 730 QVFHEMPNPEALLWNE 745 >ref|XP_007219296.1| hypothetical protein PRUPE_ppa018729mg [Prunus persica] gi|462415758|gb|EMJ20495.1| hypothetical protein PRUPE_ppa018729mg [Prunus persica] Length = 789 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/76 (46%), Positives = 50/76 (65%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 L+ SK L + L++C L WLG+ IHA LIK GFD D LKCAL++FY + WG+ ++ Sbjct: 42 LMIDSKVLCIVLKLCTSLKHLWLGLEIHACLIKSGFDLDVYLKCALINFYGTCWGIESSN 101 Query: 187 QVFVEMPLRTVSLWNK 234 Q+F EM + +WN+ Sbjct: 102 QLFHEMSDQEDIVWNE 117 >ref|XP_007135239.1| hypothetical protein PHAVU_010G112400g [Phaseolus vulgaris] gi|561008284|gb|ESW07233.1| hypothetical protein PHAVU_010G112400g [Phaseolus vulgaris] Length = 946 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/73 (46%), Positives = 46/73 (63%) Frame = +1 Query: 13 FSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQV 192 F SK L V L++C L D WLG+ +HA L+K GF D L CAL++ Y G++ A++V Sbjct: 165 FDSKALTVVLKICLALMDLWLGMEVHACLVKRGFHVDVHLSCALINLYEKCLGIDMANRV 224 Query: 193 FVEMPLRTVSLWN 231 F E PL+ LWN Sbjct: 225 FDETPLQEDFLWN 237 >ref|XP_003529895.2| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Glycine max] Length = 945 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/73 (46%), Positives = 46/73 (63%) Frame = +1 Query: 13 FSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQV 192 F SK L V L++C L + WLG+ +HA L+K GF D L CAL++ Y G++ A+QV Sbjct: 163 FDSKALTVVLKICLALMELWLGMEVHACLLKRGFQVDVHLSCALINLYEKCLGIDRANQV 222 Query: 193 FVEMPLRTVSLWN 231 F E PL+ LWN Sbjct: 223 FDETPLQEDFLWN 235 >ref|XP_003548424.2| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Glycine max] Length = 945 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/73 (46%), Positives = 46/73 (63%) Frame = +1 Query: 13 FSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQV 192 F SK L V L++C L + WLG+ +HA L+K GF D L CAL++ Y G++ A+QV Sbjct: 163 FDSKALTVVLKICLALMELWLGMEVHACLVKRGFHVDVHLSCALINLYEKYLGIDGANQV 222 Query: 193 FVEMPLRTVSLWN 231 F E PL+ LWN Sbjct: 223 FDETPLQEDFLWN 235 >ref|XP_004516409.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like isoform X1 [Cicer arietinum] gi|502179330|ref|XP_004516410.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like isoform X2 [Cicer arietinum] Length = 950 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/73 (46%), Positives = 44/73 (60%) Frame = +1 Query: 13 FSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQV 192 F SK L L++C L D W+G+ IHA LIK GF D L CAL++FY W ++ A+QV Sbjct: 167 FDSKALTFVLKICLSLRDLWVGLEIHACLIKKGFHFDVHLSCALINFYEKCWSIDKANQV 226 Query: 193 FVEMPLRTVSLWN 231 F E + LWN Sbjct: 227 FHETLYQEDFLWN 239 >ref|XP_007051582.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508703843|gb|EOX95739.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 944 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/72 (50%), Positives = 46/72 (63%) Frame = +1 Query: 19 SKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQVFV 198 SK L + L++C L D WLG+ IHA LIK GFD D LKCALM+ Y W + A+QVF Sbjct: 165 SKILTLALKMCGCLMDSWLGLQIHADLIKKGFDLDVYLKCALMNLYGRCWDLESANQVFN 224 Query: 199 EMPLRTVSLWNK 234 EM + +WN+ Sbjct: 225 EMVEKEDPVWNE 236 >ref|XP_006491254.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Citrus sinensis] Length = 938 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/77 (46%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 ++F S+ L + L++C L FWLGV +HA LIK GFD D LKCALM+FY V A+ Sbjct: 152 VIFRSRILTIILKLCTKLMAFWLGVEVHASLIKRGFDFDVHLKCALMNFYGKCRDVESAN 211 Query: 187 QVFVEM-PLRTVSLWNK 234 ++F E+ L LWN+ Sbjct: 212 KLFSEVSDLEDDLLWNE 228 >ref|XP_006444871.1| hypothetical protein CICLE_v10023767mg [Citrus clementina] gi|557547133|gb|ESR58111.1| hypothetical protein CICLE_v10023767mg [Citrus clementina] Length = 1177 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/77 (46%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 ++F S+ L + L++C L FWLGV +HA LIK GFD D LKCALM+FY V A+ Sbjct: 523 VIFRSRILTIILKLCTKLMAFWLGVEVHASLIKRGFDFDVHLKCALMNFYGKCRDVESAN 582 Query: 187 QVFVEM-PLRTVSLWNK 234 ++F E+ L LWN+ Sbjct: 583 KLFSEVSDLEDDLLWNE 599 >ref|XP_002320193.2| hypothetical protein POPTR_0014s09270g [Populus trichocarpa] gi|550323819|gb|EEE98508.2| hypothetical protein POPTR_0014s09270g [Populus trichocarpa] Length = 860 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/76 (44%), Positives = 49/76 (64%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 +VF S+ + V L++CA + + WLG+ +HA LIK GF+ D ++CALM+FY W V A+ Sbjct: 78 VVFDSRVISVVLKICAGVMNLWLGLEVHASLIKRGFELDVYVRCALMNFYGRCWCVESAN 137 Query: 187 QVFVEMPLRTVSLWNK 234 QVF E LWN+ Sbjct: 138 QVFHEPRNLDDLLWNE 153 >ref|XP_004231209.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Solanum lycopersicum] Length = 929 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/74 (44%), Positives = 46/74 (62%) Frame = +1 Query: 13 FSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQV 192 F+++ L L++C+ L D WLG+ +HA LIK GFD D KCALM+FY G A++V Sbjct: 147 FNTEILAFVLKICSKLRDMWLGLEVHACLIKKGFDLDVYTKCALMNFYGRCCGTESANKV 206 Query: 193 FVEMPLRTVSLWNK 234 F E + LWN+ Sbjct: 207 FKETSMHDSLLWNE 220 >ref|XP_004308315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 910 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/76 (40%), Positives = 50/76 (65%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 +VF S+ L L++C +L + WLG+ +HAYLIK G+D D L CAL++ Y + G+ A+ Sbjct: 125 VVFDSRVLCFVLKLCGNLKELWLGLEMHAYLIKRGYDLDVYLNCALINLYGNCLGIESAN 184 Query: 187 QVFVEMPLRTVSLWNK 234 ++F EM + LW++ Sbjct: 185 RLFDEMAKKEDMLWDE 200 >ref|XP_002523370.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537458|gb|EEF39086.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 695 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/76 (39%), Positives = 46/76 (60%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 + F S + V L++C + D WLG+ +HA LIK GF+ D ++ AL+ +Y W + A+ Sbjct: 161 VTFDSGMVTVVLKICIRVMDLWLGLEVHASLIKRGFELDTYVRSALLSYYERCWSLEIAN 220 Query: 187 QVFVEMPLRTVSLWNK 234 QVF +MP R WN+ Sbjct: 221 QVFHDMPDRDGLFWNE 236 >gb|EYU32225.1| hypothetical protein MIMGU_mgv1a001396mg [Mimulus guttatus] Length = 826 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%) Frame = +1 Query: 7 LVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYAD 186 + F S+ + L++ A+L+D LG+ IH LIK GFD D KCALM+FY W + A+ Sbjct: 41 VTFGSETMATVLKLSANLSDSLLGLEIHVCLIKKGFDHDMHSKCALMNFYGRCWDLETAN 100 Query: 187 QVFVEMPLRTVS-LWNK 234 +VF E R+ S LWN+ Sbjct: 101 KVFDESSDRSSSLLWNE 117 >gb|EXB41949.1| hypothetical protein L484_002200 [Morus notabilis] Length = 688 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/63 (41%), Positives = 43/63 (68%) Frame = +1 Query: 40 LRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQVFVEMPLRTV 219 L+ CA L+DF LG+ IH +++K+GFD D +K +L+ YA + ++ A QVF E+P +++ Sbjct: 121 LKACARLSDFQLGLRIHTHVVKVGFDCDVFVKTSLLSLYAQTGYLDRAHQVFDEIPEKSI 180 Query: 220 SLW 228 W Sbjct: 181 VSW 183 >ref|XP_003635166.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g33760-like [Vitis vinifera] Length = 561 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/77 (36%), Positives = 45/77 (58%) Frame = +1 Query: 1 DLLVFSSKDLVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNY 180 D + S+ ++ CAD++ +G IH++++ G+DSD ++ AL+ FYA S V Sbjct: 111 DSIPQSNYTFTAVIKACADISALRIGRPIHSHVLVCGYDSDSFVQAALIAFYAKSGDVGE 170 Query: 181 ADQVFVEMPLRTVSLWN 231 A +VF MP RT+ WN Sbjct: 171 AKKVFDRMPERTIIAWN 187 >ref|XP_007210330.1| hypothetical protein PRUPE_ppa002054mg [Prunus persica] gi|462406065|gb|EMJ11529.1| hypothetical protein PRUPE_ppa002054mg [Prunus persica] Length = 724 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/68 (39%), Positives = 39/68 (57%) Frame = +1 Query: 28 LVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQVFVEMP 207 ++ LR C+ LT GV IH ++K+GFDSD + AL+D YA + A +VF +P Sbjct: 301 ILAVLRACSSLTAKTRGVEIHGLVVKLGFDSDVFVGGALVDMYAKCKDIELAQKVFYRLP 360 Query: 208 LRTVSLWN 231 R + WN Sbjct: 361 ARDLVSWN 368 >ref|XP_006842799.1| hypothetical protein AMTR_s00081p00019740 [Amborella trichopoda] gi|548844955|gb|ERN04474.1| hypothetical protein AMTR_s00081p00019740 [Amborella trichopoda] Length = 533 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/68 (39%), Positives = 42/68 (61%) Frame = +1 Query: 28 LVVFLRVCADLTDFWLGVVIHAYLIKMGFDSDFDLKCALMDFYASSWGVNYADQVFVEMP 207 +V LRVC+ L+ +HA+ I+MG+D+D + AL+D YA V++A +V + MP Sbjct: 419 IVSTLRVCSSLSLLNKAKEVHAFSIRMGYDTDMYVGSALVDVYAKDGDVSHAHKVLLRMP 478 Query: 208 LRTVSLWN 231 +R V WN Sbjct: 479 MRDVISWN 486