BLASTX nr result
ID: Akebia24_contig00045671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045671 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428370.1| hypothetical protein CICLE_v10013723mg, part... 64 9e-09 emb|CAN83125.1| hypothetical protein VITISV_015109 [Vitis vinifera] 52 5e-06 ref|XP_006420258.1| hypothetical protein CICLE_v10006653mg [Citr... 55 1e-05 >ref|XP_006428370.1| hypothetical protein CICLE_v10013723mg, partial [Citrus clementina] gi|557530427|gb|ESR41610.1| hypothetical protein CICLE_v10013723mg, partial [Citrus clementina] Length = 291 Score = 63.5 bits (153), Expect(2) = 9e-09 Identities = 43/91 (47%), Positives = 50/91 (54%), Gaps = 1/91 (1%) Frame = -1 Query: 272 RFFSLLNSLKPEYENLRSNILMNPILPSLSNVCAIVQREET*RKPMTSXXXXXXXXX*I* 93 + FSLL+SLKPEYENLRSNILM P L S S VC +QREET +K M + Sbjct: 160 KIFSLLSSLKPEYENLRSNILMAPKLRSFSIVCQTIQREETRKKTMNADVKVTSEKLESH 219 Query: 92 CPCC*****ERPSGSEK-EKNY*NKGKRETY 3 E+ EK K+ NKGKRE Y Sbjct: 220 ALVA-----EKNDRKEKYGKSNRNKGKREIY 245 Score = 21.6 bits (44), Expect(2) = 9e-09 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 315 TTDVKILLKWVEEDKIF 265 T D +L + VEEDKIF Sbjct: 146 TADPIVLQQRVEEDKIF 162 >emb|CAN83125.1| hypothetical protein VITISV_015109 [Vitis vinifera] Length = 1355 Score = 52.4 bits (124), Expect(2) = 5e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -1 Query: 272 RFFSLLNSLKPEYENLRSNILMNPILPSLSNVCAIVQREET*RKPM 135 R F +L SL E+E+LR +ILM+P LPSL +VC+ +QREE RK M Sbjct: 181 RVFQVLASLGSEFEDLRCHILMSPELPSLKSVCSTIQREEVRRKVM 226 Score = 23.5 bits (49), Expect(2) = 5e-06 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 318 HTTDVKILLKWVEEDKIF 265 HT D +L K EED++F Sbjct: 166 HTVDPVVLKKRTEEDRVF 183 >ref|XP_006420258.1| hypothetical protein CICLE_v10006653mg [Citrus clementina] gi|557522131|gb|ESR33498.1| hypothetical protein CICLE_v10006653mg [Citrus clementina] Length = 152 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 260 LLNSLKPEYENLRSNILMNPILPSLSNVCAIVQREET*RKPMTS 129 LL+SLKPEYENLRSNILM LPS VC +QREET +K M + Sbjct: 90 LLSSLKPEYENLRSNILMALKLPSFFIVCQTIQREETRKKIMNA 133