BLASTX nr result
ID: Akebia24_contig00045569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045569 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050479.1| Indeterminate(ID)-domain 12 [Theobroma cacao... 57 3e-06 >ref|XP_007050479.1| Indeterminate(ID)-domain 12 [Theobroma cacao] gi|508702740|gb|EOX94636.1| Indeterminate(ID)-domain 12 [Theobroma cacao] Length = 438 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/44 (50%), Positives = 34/44 (77%) Frame = +3 Query: 81 VNVNVRDLLSFTGAVDFQRYDRDHSLIRPPGFGFADSASEAWRD 212 +++NVRD+L++ G V+ Q +R+HS ++P GFGFA+ ASE W D Sbjct: 394 ISMNVRDVLTYAGGVELQHLERNHSRLKPQGFGFAEPASETWGD 437