BLASTX nr result
ID: Akebia24_contig00045559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045559 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72527.1| hypothetical protein VITISV_009255 [Vitis vinifera] 57 2e-06 >emb|CAN72527.1| hypothetical protein VITISV_009255 [Vitis vinifera] Length = 1095 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 5/76 (6%) Frame = +1 Query: 16 INGTIPPQPQT-----GSGIPNLDLQQWMLIDKLGFTLL*NSLSEEAMSEVIGLFCSMDV 180 ++G++ P P T S PN W L D+ +LL +SL+EEAM+EV+GL + DV Sbjct: 44 VDGSVAPSPITIAVDSSSSQPNPQYVAWQLQDQRLLSLLFSSLTEEAMAEVLGLTIARDV 103 Query: 181 WQSFEQIFSHSSISRE 228 W + E FSH S +RE Sbjct: 104 WLALENSFSHISKTRE 119