BLASTX nr result
ID: Akebia24_contig00043774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00043774 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHW48354.1| glyceraldehyde-3-phosphate dehydrogenase C2-like ... 67 3e-09 gb|EYU22565.1| hypothetical protein MIMGU_mgv1a009585mg [Mimulus... 67 3e-09 gb|EXC04020.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus n... 67 3e-09 ref|XP_006578692.1| PREDICTED: glyceraldehyde-3-phosphate dehydr... 67 3e-09 ref|XP_007151566.1| hypothetical protein PHAVU_004G057600g [Phas... 67 3e-09 ref|XP_007137947.1| hypothetical protein PHAVU_009G1685000g, par... 67 3e-09 ref|XP_007137943.1| hypothetical protein PHAVU_009G1684000g, par... 67 3e-09 gb|AHA84255.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseol... 67 3e-09 gb|AGV54709.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseol... 67 3e-09 gb|AGV54256.1| glyceraldehyde-3-phosphate dehydrogenase [Phaseol... 67 3e-09 dbj|BAN45710.1| putative glycelaldehyde-3-phosphate dehydrogenas... 67 3e-09 ref|XP_004310041.1| PREDICTED: glyceraldehyde-3-phosphate dehydr... 67 3e-09 ref|XP_007222474.1| hypothetical protein PRUPE_ppa008227mg [Prun... 67 3e-09 ref|XP_007222473.1| hypothetical protein PRUPE_ppa008227mg [Prun... 67 3e-09 ref|NP_001236129.1| glyceraldehyde-3-phosphate dehydrogenase [Gl... 67 3e-09 sp|P26518.1|G3PC_MAGLI RecName: Full=Glyceraldehyde-3-phosphate ... 67 3e-09 gb|AFG28407.1| glyceraldehyde-3-phosphate dehydrogenase C2 [Pyru... 67 3e-09 ref|XP_002263145.2| PREDICTED: glyceraldehyde-3-phosphate dehydr... 67 3e-09 ref|XP_003526975.1| PREDICTED: glyceraldehyde-3-phosphate dehydr... 67 3e-09 ref|XP_003524483.1| PREDICTED: glyceraldehyde-3-phosphate dehydr... 67 3e-09 >gb|AHW48354.1| glyceraldehyde-3-phosphate dehydrogenase C2-like protein [Malus baccata] Length = 341 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 20 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 51 >gb|EYU22565.1| hypothetical protein MIMGU_mgv1a009585mg [Mimulus guttatus] Length = 337 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >gb|EXC04020.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis] Length = 349 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 28 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 59 >ref|XP_006578692.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Glycine max] Length = 338 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >ref|XP_007151566.1| hypothetical protein PHAVU_004G057600g [Phaseolus vulgaris] gi|561024875|gb|ESW23560.1| hypothetical protein PHAVU_004G057600g [Phaseolus vulgaris] Length = 337 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 17 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 48 >ref|XP_007137947.1| hypothetical protein PHAVU_009G1685000g, partial [Phaseolus vulgaris] gi|561011034|gb|ESW09941.1| hypothetical protein PHAVU_009G1685000g, partial [Phaseolus vulgaris] Length = 102 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >ref|XP_007137943.1| hypothetical protein PHAVU_009G1684000g, partial [Phaseolus vulgaris] gi|561011030|gb|ESW09937.1| hypothetical protein PHAVU_009G1684000g, partial [Phaseolus vulgaris] Length = 180 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 65 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 96 >gb|AHA84255.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseolus vulgaris] Length = 339 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >gb|AGV54709.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseolus vulgaris] Length = 338 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >gb|AGV54256.1| glyceraldehyde-3-phosphate dehydrogenase [Phaseolus vulgaris] Length = 338 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >dbj|BAN45710.1| putative glycelaldehyde-3-phosphate dehydrogenase, partial [Pyrus pyrifolia var. culta] Length = 334 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 13 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 44 >ref|XP_004310041.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Fragaria vesca subsp. vesca] Length = 336 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >ref|XP_007222474.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica] gi|462419410|gb|EMJ23673.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica] Length = 340 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 19 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 50 >ref|XP_007222473.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica] gi|462419409|gb|EMJ23672.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica] Length = 268 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 19 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 50 >ref|NP_001236129.1| glyceraldehyde-3-phosphate dehydrogenase [Glycine max] gi|85720768|gb|ABC75834.1| glyceraldehyde-3-phosphate dehydrogenase [Glycine max] Length = 338 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >sp|P26518.1|G3PC_MAGLI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic gi|19566|emb|CAA42905.1| glyceraldehyde 3-phosphate dehydrogenase [Magnolia liliiflora] Length = 341 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 18 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 49 >gb|AFG28407.1| glyceraldehyde-3-phosphate dehydrogenase C2 [Pyrus x bretschneideri] Length = 341 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 20 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 51 >ref|XP_002263145.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Vitis vinifera] Length = 337 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >ref|XP_003526975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Glycine max] Length = 338 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 16 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 47 >ref|XP_003524483.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Glycine max] Length = 337 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 133 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 228 RLVARVALQRDDVELVAVNDPFITTDYMTYMF Sbjct: 17 RLVARVALQRDDVELVAVNDPFITTDYMTYMF 48