BLASTX nr result
ID: Akebia24_contig00043495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00043495 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004304747.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 gb|EXB94227.1| hypothetical protein L484_004418 [Morus notabilis] 58 2e-06 ref|XP_007150012.1| hypothetical protein PHAVU_005G118500g [Phas... 55 8e-06 >ref|XP_004304747.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18970-like [Fragaria vesca subsp. vesca] Length = 476 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = -3 Query: 199 HAQMITNGLNCHRSVSIVGKLVEHYCAISTPIGTK-HACLILNHGDEPNVFIWNVMIRCM 23 HAQ+ITNGL +S SI GKL++HYCA+S P T +A L+ H DEPN+F+ N +IRC Sbjct: 27 HAQLITNGL---KSTSIYGKLIQHYCALSDPESTSLYAHLVFKHFDEPNLFLLNTLIRCT 83 Query: 22 PSDEAI 5 ++I Sbjct: 84 QPKDSI 89 >gb|EXB94227.1| hypothetical protein L484_004418 [Morus notabilis] Length = 466 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = -3 Query: 202 IHAQMITNGLNCHRSVSIVGKLVEHYCAISTPIGTKH-ACLILNHGDEPNVFIWNVMIRC 26 IH+Q+I NGLN S S+V K+++ Y S P H A L+ H D+PNVF+ N +IRC Sbjct: 26 IHSQLIVNGLN---SPSLVAKVIQQYFTSSNPHNNYHYAHLVFKHFDKPNVFLLNTLIRC 82 Query: 25 MPSDEAI 5 EAI Sbjct: 83 SQPKEAI 89 >ref|XP_007150012.1| hypothetical protein PHAVU_005G118500g [Phaseolus vulgaris] gi|561023276|gb|ESW22006.1| hypothetical protein PHAVU_005G118500g [Phaseolus vulgaris] Length = 465 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/66 (39%), Positives = 43/66 (65%) Frame = -3 Query: 202 IHAQMITNGLNCHRSVSIVGKLVEHYCAISTPIGTKHACLILNHGDEPNVFIWNVMIRCM 23 IHAQ+ITNGL + + + KL+EHYC T +A L+ + D+P++F++N +IRC Sbjct: 25 IHAQLITNGL---KLPAFLAKLIEHYCGSPDSHITNNAHLVFQYFDKPDLFLFNTLIRCA 81 Query: 22 PSDEAI 5 +++I Sbjct: 82 KPNDSI 87