BLASTX nr result
ID: Akebia24_contig00043407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00043407 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001383614.1| hypothetical protein PICST_57317 [Schefferso... 58 1e-06 ref|XP_007373420.1| hypothetical protein SPAPADRAFT_134444, part... 55 8e-06 >ref|XP_001383614.1| hypothetical protein PICST_57317 [Scheffersomyces stipitis CBS 6054] gi|126095763|gb|ABN65585.1| predicted protein, partial [Scheffersomyces stipitis CBS 6054] Length = 94 Score = 58.2 bits (139), Expect = 1e-06 Identities = 38/77 (49%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +1 Query: 1 PSGCQYEKTPFVVSDERPLGHFKHSLGSALITRSAYQIRSTKESR-L*IRSVT*VPQPST 177 PSGC E TPFVVSDER HF + GS+ I SAYQ TK S + RS+ Q Sbjct: 20 PSGCLDELTPFVVSDERVFRHFNFTFGSSRIASSAYQKWPTKSSSFICPRSIK--QQGLL 77 Query: 178 PNLEFGNRLRDIIPRDL 228 L+F NRLR P+DL Sbjct: 78 TYLKFENRLRSFQPQDL 94 >ref|XP_007373420.1| hypothetical protein SPAPADRAFT_134444, partial [Spathaspora passalidarum NRRL Y-27907] gi|344303587|gb|EGW33836.1| hypothetical protein SPAPADRAFT_134444, partial [Spathaspora passalidarum NRRL Y-27907] Length = 94 Score = 55.5 bits (132), Expect = 8e-06 Identities = 36/76 (47%), Positives = 43/76 (56%), Gaps = 1/76 (1%) Frame = +1 Query: 1 PSGCQYEKTPFVVSDERPLGHFKHSLGSALITRSAYQIRSTKESR-L*IRSVT*VPQPST 177 PSGC E TPFVVSDER HF + GS+ I SAYQ TK S + RS+ Q Sbjct: 20 PSGCLDELTPFVVSDERVFRHFNFTFGSSRIASSAYQKWPTKSSSFICPRSIK--QQGLL 77 Query: 178 PNLEFGNRLRDIIPRD 225 L+F N+LR P+D Sbjct: 78 TYLKFENKLRSFQPQD 93