BLASTX nr result
ID: Akebia24_contig00043359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00043359 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB52700.1| hypothetical protein L484_022477 [Morus notabilis] 59 9e-07 gb|ABX75363.1| hypothetical protein LBL9 [Panax quinquefolius] 55 8e-06 >gb|EXB52700.1| hypothetical protein L484_022477 [Morus notabilis] Length = 389 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/62 (45%), Positives = 46/62 (74%) Frame = -1 Query: 186 QKHPLLTGKVTETLAELTSAQAKEEETSLKLSQVGEELELNKANVVRLNQELEVMETAKS 7 Q++ L +++E + ++SA+AKEEE +L+LSQ+GEELE K+N RL+++L+ +E AK Sbjct: 238 QENESLKNQLSEAASNISSARAKEEEMTLRLSQLGEELETRKSNETRLSEQLKSVEAAKE 297 Query: 6 EL 1 L Sbjct: 298 AL 299 >gb|ABX75363.1| hypothetical protein LBL9 [Panax quinquefolius] Length = 245 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/62 (45%), Positives = 42/62 (67%) Frame = -1 Query: 186 QKHPLLTGKVTETLAELTSAQAKEEETSLKLSQVGEELELNKANVVRLNQELEVMETAKS 7 Q++ L K+ T +E++SAQ KE E +L+Q+GEELE +K N+V+LNQ+ +E AK Sbjct: 85 QENETLKVKLNNTTSEISSAQVKEVEMQSRLNQLGEELETSKDNIVQLNQKFGAVEGAKE 144 Query: 6 EL 1 L Sbjct: 145 AL 146