BLASTX nr result
ID: Akebia24_contig00043191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00043191 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001239936.1| ethylene-responsive transcription factor ERF... 60 3e-07 ref|NP_001239881.1| ethylene-responsive transcription factor ERF... 60 4e-07 ref|XP_007141071.1| hypothetical protein PHAVU_008G165000g [Phas... 58 1e-06 ref|XP_007019013.1| Integrase-type DNA-binding superfamily prote... 58 1e-06 ref|XP_002513787.1| Transcriptional factor TINY, putative [Ricin... 58 2e-06 ref|XP_006472752.1| PREDICTED: ethylene-responsive transcription... 57 2e-06 ref|XP_006434157.1| hypothetical protein CICLE_v10002294mg [Citr... 57 2e-06 ref|XP_006386376.1| AP2 domain-containing transcription factor f... 56 5e-06 >ref|NP_001239936.1| ethylene-responsive transcription factor ERF012-like [Glycine max] gi|212717196|gb|ACJ37439.1| AP2 domain-containing transcription factor 5 [Glycine max] Length = 231 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 5 AALLCLKGSSANLTFPITSSPIYIPDNTLMSPKSIQRV 118 AALLCLKGSSANL FP++SS YIP + +MSPKSIQRV Sbjct: 75 AALLCLKGSSANLNFPLSSSQQYIPGDAVMSPKSIQRV 112 >ref|NP_001239881.1| ethylene-responsive transcription factor ERF012-like [Glycine max] gi|212717198|gb|ACJ37440.1| AP2 domain-containing transcription factor 6 [Glycine max] Length = 232 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 5 AALLCLKGSSANLTFPITSSPIYIPDNTLMSPKSIQRV 118 AALLCLKGSSANL FP++SS YIP +MSPKSIQRV Sbjct: 78 AALLCLKGSSANLNFPLSSSQQYIPGEAVMSPKSIQRV 115 >ref|XP_007141071.1| hypothetical protein PHAVU_008G165000g [Phaseolus vulgaris] gi|561014204|gb|ESW13065.1| hypothetical protein PHAVU_008G165000g [Phaseolus vulgaris] Length = 238 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 5 AALLCLKGSSANLTFPITSSPIYIPDNTLMSPKSIQRV 118 AALLCLKGSSANL FP +SS YIP +TLMSPKSIQRV Sbjct: 75 AALLCLKGSSANLNFP-SSSSHYIPQDTLMSPKSIQRV 111 >ref|XP_007019013.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] gi|508724341|gb|EOY16238.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] Length = 216 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 5 AALLCLKGSSANLTFPITSSPIYIPDNTLMSPKSIQRV 118 AALLCLKGSSANL FPITSS YIPD T+MSPKSIQRV Sbjct: 74 AALLCLKGSSANLNFPITSSH-YIPD-TVMSPKSIQRV 109 >ref|XP_002513787.1| Transcriptional factor TINY, putative [Ricinus communis] gi|223546873|gb|EEF48370.1| Transcriptional factor TINY, putative [Ricinus communis] Length = 230 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 5 AALLCLKGSSANLTFPITSSPIYIPDNTLMSPKSIQRV 118 AALLCLKGSSANL FPITSS YIPD T+MSPKSIQR+ Sbjct: 72 AALLCLKGSSANLNFPITSSH-YIPD-TVMSPKSIQRI 107 >ref|XP_006472752.1| PREDICTED: ethylene-responsive transcription factor ERF014-like [Citrus sinensis] Length = 246 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 5 AALLCLKGSSANLTFPITSSPIYIPDNTLMSPKSIQRV 118 AAL+CLKGSSANL FPITSS YIPD T+MSPKSIQRV Sbjct: 86 AALICLKGSSANLNFPITSSH-YIPD-TVMSPKSIQRV 121 >ref|XP_006434157.1| hypothetical protein CICLE_v10002294mg [Citrus clementina] gi|557536279|gb|ESR47397.1| hypothetical protein CICLE_v10002294mg [Citrus clementina] Length = 244 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 5 AALLCLKGSSANLTFPITSSPIYIPDNTLMSPKSIQRV 118 AAL+CLKGSSANL FPITSS YIPD T+MSPKSIQRV Sbjct: 84 AALICLKGSSANLNFPITSSH-YIPD-TVMSPKSIQRV 119 >ref|XP_006386376.1| AP2 domain-containing transcription factor family protein [Populus trichocarpa] gi|148372138|gb|ABQ63000.1| RAP2-like protein [Populus trichocarpa] gi|550344573|gb|ERP64173.1| AP2 domain-containing transcription factor family protein [Populus trichocarpa] Length = 214 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 5 AALLCLKGSSANLTFPITSSPIYIPDNTLMSPKSIQRV 118 AALLCLKGSSANL FPITSS YIPD +MSPKSIQRV Sbjct: 69 AALLCLKGSSANLNFPITSSH-YIPD-AVMSPKSIQRV 104