BLASTX nr result
ID: Akebia24_contig00042175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00042175 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB26560.1| Protein ELC-like protein [Morus notabilis] 77 3e-12 ref|XP_004505700.1| PREDICTED: protein ELC-like [Cicer arietinum] 75 9e-12 ref|XP_003607267.1| Protein ELC [Medicago truncatula] gi|3555083... 74 2e-11 ref|XP_002520971.1| conserved hypothetical protein [Ricinus comm... 73 4e-11 ref|XP_002271662.1| PREDICTED: protein ELC [Vitis vinifera] 72 1e-10 ref|XP_007131605.1| hypothetical protein PHAVU_011G027400g [Phas... 71 1e-10 ref|XP_003540630.1| PREDICTED: protein ELC-like [Glycine max] 71 2e-10 ref|XP_007010746.1| Ubiquitin-conjugating enzyme/RWD-like protei... 70 2e-10 ref|XP_004296692.1| PREDICTED: protein ELC-like [Fragaria vesca ... 70 4e-10 ref|XP_003537763.1| PREDICTED: protein ELC-like [Glycine max] 70 4e-10 ref|XP_006432352.1| hypothetical protein CICLE_v10001331mg [Citr... 69 5e-10 gb|EPS63144.1| hypothetical protein M569_11641 [Genlisea aurea] 69 5e-10 emb|CBI16582.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_002275919.1| PREDICTED: protein ELC-like [Vitis vinifera] 69 5e-10 ref|XP_002525563.1| protein with unknown function [Ricinus commu... 69 5e-10 ref|XP_006407335.1| hypothetical protein EUTSA_v10022018mg [Eutr... 69 7e-10 ref|XP_002274974.1| PREDICTED: protein ELC-like [Vitis vinifera] 69 9e-10 gb|EYU19930.1| hypothetical protein MIMGU_mgv1a007629mg [Mimulus... 68 1e-09 gb|EXB62712.1| Protein ELC [Morus notabilis] 68 1e-09 ref|XP_006855196.1| hypothetical protein AMTR_s00051p00167090 [A... 68 1e-09 >gb|EXB26560.1| Protein ELC-like protein [Morus notabilis] Length = 349 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/58 (56%), Positives = 48/58 (82%) Frame = +3 Query: 3 DRMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNS 176 +++++CL D+A+ED++YAL+ VE+GVV Y+K+VR L+REQF+HRAMLVKLR S Sbjct: 284 EKLLDCLAADRAVEDVIYALDKAVEEGVVSLEGYIKQVRALAREQFYHRAMLVKLRGS 341 >ref|XP_004505700.1| PREDICTED: protein ELC-like [Cicer arietinum] Length = 376 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/59 (57%), Positives = 45/59 (76%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNSDI 182 +M++C D AIED LYAL+ GV+ G VPF+QYL+ VR LSREQFFHRA+ K+R + + Sbjct: 301 QMLDCTAADLAIEDTLYALDKGVQVGAVPFDQYLRSVRVLSREQFFHRAIAAKVRAAQL 359 >ref|XP_003607267.1| Protein ELC [Medicago truncatula] gi|355508322|gb|AES89464.1| Protein ELC [Medicago truncatula] Length = 411 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/59 (57%), Positives = 44/59 (74%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNSDI 182 +M++C D AIED LYAL+ GV+ G VPF+QYL+ VR LSREQFFHRA K+R + + Sbjct: 337 QMLDCTSADLAIEDTLYALDKGVQVGSVPFDQYLRSVRALSREQFFHRATAAKVRAAQL 395 >ref|XP_002520971.1| conserved hypothetical protein [Ricinus communis] gi|223539808|gb|EEF41388.1| conserved hypothetical protein [Ricinus communis] Length = 338 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (1%) Frame = +3 Query: 9 MINCLEQDQAIEDLLYALENGVEKGVVP-FNQYLKKVRTLSREQFFHRAMLVKLRNSDI 182 +I+CL ++AIED++YAL+ VE+G VP F+ YL++VR L+REQF+HRA LVKLR DI Sbjct: 275 VIDCLAAERAIEDVIYALDKAVEEGAVPCFDAYLRQVRLLAREQFYHRARLVKLRGPDI 333 >ref|XP_002271662.1| PREDICTED: protein ELC [Vitis vinifera] Length = 425 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M++C D +IED +YAL+ V++G + F+QYLK VR LSREQFFHRAM KLR Sbjct: 350 QMLDCTSSDLSIEDTIYALDKAVQEGSISFDQYLKNVRLLSREQFFHRAMCAKLR 404 >ref|XP_007131605.1| hypothetical protein PHAVU_011G027400g [Phaseolus vulgaris] gi|561004605|gb|ESW03599.1| hypothetical protein PHAVU_011G027400g [Phaseolus vulgaris] Length = 412 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNSDI 182 +M++C D AIED LYAL+ ++ G VPF+QYL+ VR LSREQFFHRA K+R + + Sbjct: 338 QMLDCTASDLAIEDTLYALDKALQVGAVPFDQYLRSVRALSREQFFHRATTAKVRAAQL 396 >ref|XP_003540630.1| PREDICTED: protein ELC-like [Glycine max] Length = 405 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNSDI 182 +M++C D AIED LYAL+ ++ G VPF+QYL+ VR LSREQFFHRA K+R + + Sbjct: 331 QMLDCTAADLAIEDTLYALDKALQVGAVPFDQYLRSVRALSREQFFHRATATKVRAAQL 389 >ref|XP_007010746.1| Ubiquitin-conjugating enzyme/RWD-like protein [Theobroma cacao] gi|508727659|gb|EOY19556.1| Ubiquitin-conjugating enzyme/RWD-like protein [Theobroma cacao] Length = 409 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M++C D AIED++Y+L+ V+ G VPF+QYL+ VR LSREQFFHRA K+R Sbjct: 335 QMLDCTSADLAIEDVVYSLDKAVQDGAVPFDQYLRNVRLLSREQFFHRATAAKVR 389 >ref|XP_004296692.1| PREDICTED: protein ELC-like [Fragaria vesca subsp. vesca] Length = 404 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M+ C D AIED++Y+L+ V+ G VPF+QYL+ VR LSREQFFHRA K+R Sbjct: 329 QMLECTASDLAIEDVVYSLDKAVQDGAVPFDQYLRTVRLLSREQFFHRATAAKVR 383 >ref|XP_003537763.1| PREDICTED: protein ELC-like [Glycine max] Length = 415 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNSDI 182 +M++C D AIED LYAL+ ++ G VPF+QYL+ VR LSREQFFHRA K+R + + Sbjct: 341 QMLDCTAADLAIEDTLYALDKALQVGGVPFDQYLRSVRALSREQFFHRATAAKVRAAQL 399 >ref|XP_006432352.1| hypothetical protein CICLE_v10001331mg [Citrus clementina] gi|568883787|ref|XP_006494627.1| PREDICTED: protein ELC-like [Citrus sinensis] gi|557534474|gb|ESR45592.1| hypothetical protein CICLE_v10001331mg [Citrus clementina] Length = 409 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M++C D AIED++YAL+ +++G VPF+ YL+ VR LSREQFFHRA K+R Sbjct: 335 QMLDCTSADLAIEDVVYALDKALQEGAVPFDSYLRNVRLLSREQFFHRATAAKVR 389 >gb|EPS63144.1| hypothetical protein M569_11641 [Genlisea aurea] Length = 393 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M++C D A+ED +Y L+ V++G VPF+QYL+ VR LSREQFFHRA K+R Sbjct: 318 QMLDCTASDLAVEDTIYGLDRAVQEGAVPFDQYLRNVRLLSREQFFHRATASKVR 372 >emb|CBI16582.3| unnamed protein product [Vitis vinifera] Length = 250 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/59 (50%), Positives = 43/59 (72%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNSDI 182 +M+ C D AI+D++YAL+ +++G +PF+QYLK VR LSREQF HRAM K R + + Sbjct: 179 QMLECSSSDLAIDDVIYALDKALQEGSIPFDQYLKNVRMLSREQFLHRAMSAKARATQL 237 >ref|XP_002275919.1| PREDICTED: protein ELC-like [Vitis vinifera] Length = 364 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/59 (50%), Positives = 43/59 (72%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNSDI 182 +M+ C D AI+D++YAL+ +++G +PF+QYLK VR LSREQF HRAM K R + + Sbjct: 293 QMLECSSSDLAIDDVIYALDKALQEGSIPFDQYLKNVRMLSREQFLHRAMSAKARATQL 351 >ref|XP_002525563.1| protein with unknown function [Ricinus communis] gi|223535142|gb|EEF36822.1| protein with unknown function [Ricinus communis] Length = 419 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M+ C D AIED++Y+L+ V++GVVPF+QYL+ VR LSREQFF RA K+R Sbjct: 345 QMLECTSADLAIEDVVYSLDKAVQEGVVPFDQYLRNVRLLSREQFFQRATAAKVR 399 >ref|XP_006407335.1| hypothetical protein EUTSA_v10022018mg [Eutrema salsugineum] gi|557108481|gb|ESQ48788.1| hypothetical protein EUTSA_v10022018mg [Eutrema salsugineum] Length = 397 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M+ C D AIED +YAL+ + GVVPF+QYL+ VR LSREQFFHRA K+R Sbjct: 326 QMLECTALDLAIEDAIYALDKSFQDGVVPFDQYLRNVRLLSREQFFHRATASKVR 380 >ref|XP_002274974.1| PREDICTED: protein ELC-like [Vitis vinifera] Length = 336 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/62 (51%), Positives = 46/62 (74%) Frame = +3 Query: 9 MINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLRNSDIFH 188 +++ L D+A+EDL+Y L+ VE+GVV Y+K+VR +REQFF+RAML+KL+ DI H Sbjct: 274 VLDQLAGDKAMEDLMYELDKAVEQGVVTLQAYIKEVRATAREQFFNRAMLLKLKGPDILH 333 Query: 189 GL 194 L Sbjct: 334 WL 335 >gb|EYU19930.1| hypothetical protein MIMGU_mgv1a007629mg [Mimulus guttatus] Length = 401 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M++C D A+ED +YAL+ ++G VPF+QYL+ VR L+REQFFHRA K+R Sbjct: 325 QMLDCTASDLAVEDTIYALDKAAQEGAVPFDQYLRNVRLLAREQFFHRATASKVR 379 >gb|EXB62712.1| Protein ELC [Morus notabilis] Length = 404 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M+NC D A+ED++YAL+ ++ G +PF+ YL+ VR LSREQFFHRA K+R Sbjct: 330 QMLNCTAGDLAVEDVVYALDKALQDGAIPFDLYLRNVRLLSREQFFHRATAAKVR 384 >ref|XP_006855196.1| hypothetical protein AMTR_s00051p00167090 [Amborella trichopoda] gi|548858949|gb|ERN16663.1| hypothetical protein AMTR_s00051p00167090 [Amborella trichopoda] Length = 411 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = +3 Query: 6 RMINCLEQDQAIEDLLYALENGVEKGVVPFNQYLKKVRTLSREQFFHRAMLVKLR 170 +M+ C D AIED++Y L+ V++G +PF+ YLK +R LSREQFFHRA K+R Sbjct: 336 QMLECTAADLAIEDVIYLLDKAVQEGAIPFDAYLKSIRALSREQFFHRATSAKVR 390