BLASTX nr result
ID: Akebia24_contig00041490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041490 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68838.1| hypothetical protein VITISV_030956 [Vitis vinifera] 40 8e-06 >emb|CAN68838.1| hypothetical protein VITISV_030956 [Vitis vinifera] Length = 1881 Score = 39.7 bits (91), Expect(2) = 8e-06 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = -1 Query: 370 DFNVIRFSYEKMGGSRITRTMTEFSNFV 287 DFNVIR S EK+GGSR+T +M +F +F+ Sbjct: 969 DFNVIRRSSEKLGGSRLTPSMKDFDDFI 996 Score = 35.4 bits (80), Expect(2) = 8e-06 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -3 Query: 212 LCPKLEQFLVSSFWETTFLNVFQEALCRSALDYYPILL 99 +C +L++FL S+ WE TF Q L R D++PI+L Sbjct: 1021 VCKRLDRFLYSNEWEQTFPQSIQGVLPRWTSDHWPIVL 1058