BLASTX nr result
ID: Akebia24_contig00041363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041363 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659... 72 6e-11 ref|XP_007144608.1| hypothetical protein PHAVU_007G169700g [Phas... 71 2e-10 ref|XP_007162403.1| hypothetical protein PHAVU_001G149100g [Phas... 70 3e-10 ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Popu... 68 1e-09 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_007200898.1| hypothetical protein PRUPE_ppb017528mg [Prun... 62 6e-08 ref|NP_001078332.1| protein ROTUNDIFOLIA like 14 [Arabidopsis t... 55 8e-06 >ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659834 [Glycine max] Length = 45 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 81 AANSFLLRIPRIRTWKRCSRNVQQQRARAYIIWRCTVMLLCWHE 212 AAN F +R ++R+W+RCS+ V+QQR R YIIWRCTV+LLCWHE Sbjct: 2 AANVFSVRGSKVRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_007144608.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] gi|561017798|gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] Length = 45 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 81 AANSFLLRIPRIRTWKRCSRNVQQQRARAYIIWRCTVMLLCWHE 212 AA+ F +R +IR+W+RCS+ V+QQR R YIIWRCTV+LLCWHE Sbjct: 2 AASVFSVRGSKIRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_007162403.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] gi|561035867|gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] Length = 70 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = +3 Query: 39 NSHTHTFNFLVSMAAANSFL--LRIPRIRTWKRCSRNVQQQRARAYIIWRCTVMLLCWHE 212 ++H T NF ++ A + LR ++R W RCS+ ++QQR R YIIWRCTV+LLCWH+ Sbjct: 11 HNHNLTLNFTMTTATTTAMFSSLRASKLRPWGRCSKYIRQQRTRLYIIWRCTVLLLCWHD 70 >ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] gi|222861166|gb|EEE98708.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] Length = 64 Score = 68.2 bits (165), Expect = 1e-09 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = +3 Query: 81 AANSFLLRIPRIRTWKRCSRNVQQQRARAYIIWRCTVMLLCWHE 212 AA++ +R ++R+W+RCS+ +++QR R YIIWRCTVMLLCWH+ Sbjct: 21 AADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +3 Query: 75 MAAANSFLLRIPRIRTWKRCSRNVQQQRARAYIIWRCTVMLLCWHE 212 MA+ S +R P+ R+W+RCSR V++QR R YIIWRCTV+LL W + Sbjct: 1 MASQRSAWIRFPKFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46 >ref|XP_007200898.1| hypothetical protein PRUPE_ppb017528mg [Prunus persica] gi|462396298|gb|EMJ02097.1| hypothetical protein PRUPE_ppb017528mg [Prunus persica] Length = 67 Score = 62.4 bits (150), Expect = 6e-08 Identities = 21/34 (61%), Positives = 31/34 (91%) Frame = +3 Query: 111 RIRTWKRCSRNVQQQRARAYIIWRCTVMLLCWHE 212 ++R W RCS+++++QRAR YI+WRC+VMLLCWH+ Sbjct: 34 KLRPWTRCSKHIREQRARLYIVWRCSVMLLCWHD 67 >ref|NP_001078332.1| protein ROTUNDIFOLIA like 14 [Arabidopsis thaliana] gi|42822061|tpg|DAA02285.1| TPA_exp: DVL14 [Arabidopsis thaliana] gi|332646912|gb|AEE80433.1| protein rotundifolia like 14 [Arabidopsis thaliana] Length = 48 Score = 55.5 bits (132), Expect = 8e-06 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = +3 Query: 105 IPRIRTWKRCSRNVQQQRARAYIIWRCTVMLLCWHE 212 + ++RTWKRCS+ +++QRAR YIIW+C V LL H+ Sbjct: 13 VTKVRTWKRCSKQIKEQRARLYIIWKCAVFLLSSHD 48