BLASTX nr result
ID: Akebia24_contig00041323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041323 (587 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40500.1| Putative reverse transcriptase, identical [Solanu... 39 5e-06 >gb|AAT40500.1| Putative reverse transcriptase, identical [Solanum demissum] Length = 213 Score = 38.5 bits (88), Expect(2) = 5e-06 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Frame = -3 Query: 393 VSSQVLCDQHIPIKLKEILYD--VRLAHLNGVECLVIKK-HVYKLIIVE 256 ++S VLCD+ IP+KLK Y VR A L G EC +K HV+K+ + E Sbjct: 67 LASGVLCDKKIPLKLKGKFYRVVVRPALLYGAECWPVKNAHVHKMHVAE 115 Score = 37.7 bits (86), Expect(2) = 5e-06 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = -1 Query: 215 KTRSESIYVNVGVTQVGDKLRESLLSWFGYV*QR 114 K R+E I VGV V DKLRE+ L WFG+V +R Sbjct: 130 KIRNEVIREKVGVASVVDKLREARLRWFGHVKRR 163