BLASTX nr result
ID: Akebia24_contig00041312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041312 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518409.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_002534685.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002518409.1| conserved hypothetical protein [Ricinus communis] gi|223542254|gb|EEF43796.1| conserved hypothetical protein [Ricinus communis] Length = 338 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/44 (63%), Positives = 29/44 (65%) Frame = +1 Query: 85 FRLGFVPEAKLLRRVASPLLHSLWRRKXXXXXXXXXXXXXXFDW 216 FRLGFVPEAKL RRVASPLL+SLWRRK FDW Sbjct: 295 FRLGFVPEAKLRRRVASPLLYSLWRRKLKELTGELMLTLNLFDW 338 >ref|XP_002534685.1| conserved hypothetical protein [Ricinus communis] gi|223524769|gb|EEF27699.1| conserved hypothetical protein [Ricinus communis] Length = 65 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/44 (63%), Positives = 29/44 (65%) Frame = +1 Query: 85 FRLGFVPEAKLLRRVASPLLHSLWRRKXXXXXXXXXXXXXXFDW 216 FRLGFVPEAKL RRVASPLL+SLWRRK FDW Sbjct: 22 FRLGFVPEAKLRRRVASPLLYSLWRRKLEELTGELTLTLSLFDW 65