BLASTX nr result
ID: Akebia24_contig00041086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041086 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064095.1| orf105b gene product (mitochondrion) [Beta vulg... 112 5e-23 ref|XP_002535404.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_002535501.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 >ref|NP_064095.1| orf105b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435118|ref|YP_004222336.1| hypothetical protein BevumaM_p102 [Beta vulgaris subsp. maritima] gi|346683210|ref|YP_004842142.1| hypothetical protein BemaM_p098 [Beta macrocarpa] gi|9087344|dbj|BAA99488.1| orf105b [Beta vulgaris subsp. vulgaris] gi|317905672|emb|CBJ14067.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439851|emb|CBJ17557.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148061|emb|CBJ20724.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500128|emb|CBX24947.1| hypothetical protein [Beta macrocarpa] gi|384939126|emb|CBL51972.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 105 Score = 112 bits (280), Expect = 5e-23 Identities = 55/62 (88%), Positives = 57/62 (91%) Frame = -3 Query: 186 MKRQGTIHSSPAGLSRVRGPIRSTSDRFTEQGVKQGPGD*WKNLAEVSVVFNSAGWLVGR 7 MKRQGT+HS AGLSRVR PIRSTSDRFTEQGVKQGPG WKNLAEVS+VFNSAGWLVGR Sbjct: 1 MKRQGTMHSPRAGLSRVRSPIRSTSDRFTEQGVKQGPGYLWKNLAEVSIVFNSAGWLVGR 60 Query: 6 IA 1 IA Sbjct: 61 IA 62 >ref|XP_002535404.1| conserved hypothetical protein [Ricinus communis] gi|223523222|gb|EEF26978.1| conserved hypothetical protein [Ricinus communis] Length = 105 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 186 MKRQGTIHSSPAGLSRVRGPIRSTSDRFTEQGVK 85 MKRQGT+HSS AGLSRVRGPIRSTSDRFTEQGV+ Sbjct: 1 MKRQGTMHSSRAGLSRVRGPIRSTSDRFTEQGVQ 34 >ref|XP_002535501.1| conserved hypothetical protein [Ricinus communis] gi|223522871|gb|EEF26883.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 186 MKRQGTIHSSPAGLSRVRGPIRSTSDRFTEQGVK 85 MKRQGT+HSS AGLSRVRGPIRSTSDRFTEQGV+ Sbjct: 1 MKRQGTMHSSRAGLSRVRGPIRSTSDRFTEQGVQ 34