BLASTX nr result
ID: Akebia24_contig00040584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00040584 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006593261.1| PREDICTED: uncharacterized mitochondrial pro... 55 8e-06 >ref|XP_006593261.1| PREDICTED: uncharacterized mitochondrial protein AtMg01410-like [Glycine max] Length = 194 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/52 (50%), Positives = 31/52 (59%) Frame = -1 Query: 207 PTVFYMMGQPLGSLGSWPAFALCHHLVIQFCAQRAYGTFGFFDYALLSVMTC 52 P V + GQPLG L SWP F L HHLV+Q CA++ Y F YA+L C Sbjct: 76 PVVSFETGQPLGYLSSWPLFTLSHHLVLQSCAEKVYPGRYFDRYAILGDDIC 127