BLASTX nr result
ID: Akebia24_contig00039458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00039458 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB46333.1| hypothetical protein L484_009478 [Morus notabilis] 57 3e-06 >gb|EXB46333.1| hypothetical protein L484_009478 [Morus notabilis] Length = 178 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = -1 Query: 306 MDEIMNKMGGYWFSRKANKELDSVGDDFDVKFLPL 202 MD+I+NK+G YWFS+KANKEL+SVGDD +K+ P+ Sbjct: 1 MDQILNKVGSYWFSQKANKELNSVGDDISLKYEPV 35