BLASTX nr result
ID: Akebia24_contig00039267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00039267 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49786.1| hypothetical protein DOTSEDRAFT_40928 [Dothistrom... 67 3e-09 ref|XP_003857345.1| hypothetical protein MYCGRDRAFT_78594 [Zymos... 64 2e-08 gb|EMF17642.1| hypothetical protein SEPMUDRAFT_146608 [Sphaeruli... 61 2e-07 gb|EME87483.1| putative GPI anchored protein [Pseudocercospora f... 60 4e-07 ref|XP_007586945.1| putative gpi anchored protein [Neofusicoccum... 59 5e-07 gb|EPE36346.1| hypothetical protein GLAREA_05684 [Glarea lozoyen... 58 1e-06 gb|EKG22148.1| Cell wall beta-glucan synthesis [Macrophomina pha... 57 3e-06 gb|EON64296.1| hypothetical protein W97_03527 [Coniosporium apol... 56 5e-06 >gb|EME49786.1| hypothetical protein DOTSEDRAFT_40928 [Dothistroma septosporum NZE10] Length = 176 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/59 (47%), Positives = 41/59 (69%) Frame = +1 Query: 1 ASNLAQGTVIGSNLDNSGSYTYTAPETITAGDDYALQIVDTEDPANNNYSGMFVLDSPN 177 ++NLA+GT I +N+ NSGSYT+ P++I G Y ++IV DP+ NY+ FV+DS N Sbjct: 59 SNNLAEGTTIAANIANSGSYTWNVPDSIARGSSYTVEIVSDSDPSETNYTPAFVVDSSN 117 >ref|XP_003857345.1| hypothetical protein MYCGRDRAFT_78594 [Zymoseptoria tritici IPO323] gi|339477230|gb|EGP92321.1| hypothetical protein MYCGRDRAFT_78594 [Zymoseptoria tritici IPO323] Length = 208 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/59 (49%), Positives = 41/59 (69%) Frame = +1 Query: 1 ASNLAQGTVIGSNLDNSGSYTYTAPETITAGDDYALQIVDTEDPANNNYSGMFVLDSPN 177 +S+L +GTVI ++ N+G YT+T G DYALQI++ DP++NNYS FVL+S N Sbjct: 59 SSDLNKGTVIAADAPNNGEYTWTPDADTVRGSDYALQIINNADPSDNNYSAYFVLESDN 117 >gb|EMF17642.1| hypothetical protein SEPMUDRAFT_146608 [Sphaerulina musiva SO2202] Length = 215 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/59 (47%), Positives = 38/59 (64%) Frame = +1 Query: 1 ASNLAQGTVIGSNLDNSGSYTYTAPETITAGDDYALQIVDTEDPANNNYSGMFVLDSPN 177 ++NL GT I SN++NSGSYT+T G DY +QI++ ++ NYS FVLDS N Sbjct: 62 SNNLNAGTTIASNIENSGSYTWTPDSDAVRGSDYTIQIINDQNDEEVNYSPYFVLDSDN 120 >gb|EME87483.1| putative GPI anchored protein [Pseudocercospora fijiensis CIRAD86] Length = 221 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/59 (47%), Positives = 38/59 (64%) Frame = +1 Query: 1 ASNLAQGTVIGSNLDNSGSYTYTAPETITAGDDYALQIVDTEDPANNNYSGMFVLDSPN 177 ++NLA GTVI S + N+GSYT+T + T G DY ++IV D + NY+ FVL S N Sbjct: 65 SNNLAAGTVIASKIANTGSYTWTPDKDTTRGSDYTIEIVSDSDSSATNYTPYFVLQSDN 123 >ref|XP_007586945.1| putative gpi anchored protein [Neofusicoccum parvum UCRNP2] gi|485919166|gb|EOD45586.1| putative gpi anchored protein [Neofusicoccum parvum UCRNP2] Length = 235 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/57 (40%), Positives = 37/57 (64%) Frame = +1 Query: 1 ASNLAQGTVIGSNLDNSGSYTYTAPETITAGDDYALQIVDTEDPANNNYSGMFVLDS 171 +++L +G+ I +DNSGSYT+ P + G DY ++I++ +DP NY FV+DS Sbjct: 60 SNDLKEGSPIAEKIDNSGSYTWAVPSDVVRGSDYTIEIINDDDPTETNYFPYFVIDS 116 >gb|EPE36346.1| hypothetical protein GLAREA_05684 [Glarea lozoyensis ATCC 20868] Length = 285 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/58 (44%), Positives = 37/58 (63%) Frame = +1 Query: 4 SNLAQGTVIGSNLDNSGSYTYTAPETITAGDDYALQIVDTEDPANNNYSGMFVLDSPN 177 +NLA ++IG L N+G YTY P T+ +G YA QI D+++ + NYS F + SPN Sbjct: 64 NNLAIISIIGEELPNTGFYTYLPPPTLISGTGYAFQITDSDNETDTNYSPQFAITSPN 121 >gb|EKG22148.1| Cell wall beta-glucan synthesis [Macrophomina phaseolina MS6] Length = 232 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/57 (36%), Positives = 37/57 (64%) Frame = +1 Query: 1 ASNLAQGTVIGSNLDNSGSYTYTAPETITAGDDYALQIVDTEDPANNNYSGMFVLDS 171 ++NL +G+ I ++N+GSYT++ P G DY ++I++ +DP NY F++DS Sbjct: 60 SNNLKEGSPIAEKIENTGSYTWSVPSDTVRGSDYTIEIINDDDPTETNYFPYFIIDS 116 >gb|EON64296.1| hypothetical protein W97_03527 [Coniosporium apollinis CBS 100218] Length = 245 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/59 (42%), Positives = 38/59 (64%) Frame = +1 Query: 1 ASNLAQGTVIGSNLDNSGSYTYTAPETITAGDDYALQIVDTEDPANNNYSGMFVLDSPN 177 +S+L G I +++ N+GSYT+T ++T G DY +QIV DP NY+ FV++S N Sbjct: 60 SSSLDGGAAIATSIPNTGSYTWTPDPSVTRGSDYTIQIVSDTDPTLVNYTPFFVIESSN 118