BLASTX nr result
ID: Akebia24_contig00038762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00038762 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039721.1| Tetratricopeptide repeat (TPR)-like superfam... 110 2e-22 ref|XP_002961361.1| hypothetical protein SELMODRAFT_76175 [Selag... 109 4e-22 ref|XP_002980913.1| hypothetical protein SELMODRAFT_113567 [Sela... 109 4e-22 ref|XP_006282848.1| hypothetical protein CARUB_v10006791mg [Caps... 108 8e-22 ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|XP_002265980.2| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|NP_680717.2| pentatricopeptide repeat-containing protein [Ar... 107 1e-21 emb|CBI23541.3| unnamed protein product [Vitis vinifera] 107 1e-21 ref|XP_006477110.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_006440204.1| hypothetical protein CICLE_v10019492mg [Citr... 107 2e-21 ref|XP_006414294.1| hypothetical protein EUTSA_v10024626mg [Eutr... 107 2e-21 emb|CAA06832.1| DYW10 protein [Arabidopsis thaliana] 106 3e-21 gb|EXB64625.1| hypothetical protein L484_017957 [Morus notabilis] 106 4e-21 ref|XP_004301739.1| PREDICTED: pentatricopeptide repeat-containi... 106 4e-21 ref|XP_004295338.1| PREDICTED: pentatricopeptide repeat-containi... 106 4e-21 ref|XP_007155703.1| hypothetical protein PHAVU_003G224100g [Phas... 105 6e-21 ref|XP_007210130.1| hypothetical protein PRUPE_ppa022577mg [Prun... 105 6e-21 ref|XP_004972826.1| PREDICTED: pentatricopeptide repeat-containi... 105 8e-21 ref|XP_007214219.1| hypothetical protein PRUPE_ppa023254mg [Prun... 105 8e-21 >ref|XP_007039721.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508776966|gb|EOY24222.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 685 Score = 110 bits (275), Expect = 2e-22 Identities = 49/58 (84%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I PSG IRVFKNLRVCGDCH AIKYISAIE REIIVRDT RFHHF++GSCSCGDYW Sbjct: 628 IKVPSGGPIRVFKNLRVCGDCHRAIKYISAIETREIIVRDTVRFHHFKDGSCSCGDYW 685 >ref|XP_002961361.1| hypothetical protein SELMODRAFT_76175 [Selaginella moellendorffii] gi|300170020|gb|EFJ36621.1| hypothetical protein SELMODRAFT_76175 [Selaginella moellendorffii] Length = 1121 Score = 109 bits (272), Expect = 4e-22 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 +STP GS +R+ KNLR CGDCH AIK ISAIEGREI+VRD+ RFHHFRNGSCSCGDYW Sbjct: 1064 LSTPPGSSLRIIKNLRACGDCHTAIKLISAIEGREIVVRDSNRFHHFRNGSCSCGDYW 1121 >ref|XP_002980913.1| hypothetical protein SELMODRAFT_113567 [Selaginella moellendorffii] gi|300151452|gb|EFJ18098.1| hypothetical protein SELMODRAFT_113567 [Selaginella moellendorffii] Length = 809 Score = 109 bits (272), Expect = 4e-22 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 +STP GS +R+ KNLR CGDCH AIK ISAIEGREI+VRD+ RFHHFRNGSCSCGDYW Sbjct: 752 LSTPPGSSLRIIKNLRACGDCHTAIKLISAIEGREIVVRDSNRFHHFRNGSCSCGDYW 809 >ref|XP_006282848.1| hypothetical protein CARUB_v10006791mg [Capsella rubella] gi|482551553|gb|EOA15746.1| hypothetical protein CARUB_v10006791mg [Capsella rubella] Length = 662 Score = 108 bits (270), Expect = 8e-22 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I P GS+I+VFKNLR+CGDCH AIK+IS IE REI+VRDTTRFHHF+NGSCSCGDYW Sbjct: 605 IKLPQGSQIQVFKNLRICGDCHKAIKFISEIEKREIMVRDTTRFHHFKNGSCSCGDYW 662 >ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 107 bits (268), Expect = 1e-21 Identities = 48/58 (82%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 + T G+ IRVFKNLRVCGDCH AIK+ISAIE REIIVRDTTRFHHFRNG CSCGDYW Sbjct: 610 MKTAPGTPIRVFKNLRVCGDCHRAIKFISAIEKREIIVRDTTRFHHFRNGFCSCGDYW 667 >ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 107 bits (268), Expect = 1e-21 Identities = 48/58 (82%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 + T G+ IRVFKNLRVCGDCH AIK+ISAIE REIIVRDTTRFHHFRNG CSCGDYW Sbjct: 610 MKTAPGTPIRVFKNLRVCGDCHRAIKFISAIEKREIIVRDTTRFHHFRNGFCSCGDYW 667 >ref|XP_002265980.2| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like, partial [Vitis vinifera] Length = 599 Score = 107 bits (268), Expect = 1e-21 Identities = 48/58 (82%), Positives = 50/58 (86%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I P G+ IRVFKNLRVCGDCH+A KYISAIEGR IIVRDTTRFHHFR G CSCGDYW Sbjct: 542 IRMPLGTPIRVFKNLRVCGDCHSATKYISAIEGRVIIVRDTTRFHHFRQGECSCGDYW 599 >ref|NP_680717.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|357529479|sp|Q9M4P3.3|PP316_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g16835, mitochondrial; AltName: Full=Protein DYW10; Flags: Precursor gi|332658412|gb|AEE83812.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 656 Score = 107 bits (268), Expect = 1e-21 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I P GS+I+VFKNLR+CGDCH AIK+IS IE REIIVRDTTRFHHF++GSCSCGDYW Sbjct: 599 IKLPQGSQIQVFKNLRICGDCHKAIKFISEIEKREIIVRDTTRFHHFKDGSCSCGDYW 656 >emb|CBI23541.3| unnamed protein product [Vitis vinifera] Length = 385 Score = 107 bits (268), Expect = 1e-21 Identities = 48/58 (82%), Positives = 50/58 (86%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I P G+ IRVFKNLRVCGDCH+A KYISAIEGR IIVRDTTRFHHFR G CSCGDYW Sbjct: 328 IRMPLGTPIRVFKNLRVCGDCHSATKYISAIEGRVIIVRDTTRFHHFRQGECSCGDYW 385 >ref|XP_006477110.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Citrus sinensis] Length = 669 Score = 107 bits (267), Expect = 2e-21 Identities = 47/58 (81%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I P G+ IRVFKNLRVCGDCH A KYISAIE REIIVRDTTRFHHF++G+CSCGDYW Sbjct: 612 IKVPLGTPIRVFKNLRVCGDCHRATKYISAIEKREIIVRDTTRFHHFKDGTCSCGDYW 669 >ref|XP_006440204.1| hypothetical protein CICLE_v10019492mg [Citrus clementina] gi|557542466|gb|ESR53444.1| hypothetical protein CICLE_v10019492mg [Citrus clementina] Length = 571 Score = 107 bits (267), Expect = 2e-21 Identities = 47/58 (81%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I P G+ IRVFKNLRVCGDCH A KYISAIE REIIVRDTTRFHHF++G+CSCGDYW Sbjct: 514 IKVPLGTPIRVFKNLRVCGDCHRATKYISAIEKREIIVRDTTRFHHFKDGTCSCGDYW 571 >ref|XP_006414294.1| hypothetical protein EUTSA_v10024626mg [Eutrema salsugineum] gi|557115464|gb|ESQ55747.1| hypothetical protein EUTSA_v10024626mg [Eutrema salsugineum] Length = 661 Score = 107 bits (267), Expect = 2e-21 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 + P GSRI+VFKNLR+CGDCH AIK+IS IE REI+VRDTTRFHHF++GSCSCGDYW Sbjct: 604 LKLPEGSRIQVFKNLRICGDCHKAIKFISEIERREIMVRDTTRFHHFKDGSCSCGDYW 661 >emb|CAA06832.1| DYW10 protein [Arabidopsis thaliana] Length = 105 Score = 106 bits (265), Expect = 3e-21 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I P GS I+VFKNLR+CGDCH AIK+IS IE REIIVRDTTRFHHF++GSCSCGDYW Sbjct: 48 IKLPEGSPIQVFKNLRICGDCHKAIKFISEIEKREIIVRDTTRFHHFKDGSCSCGDYW 105 >gb|EXB64625.1| hypothetical protein L484_017957 [Morus notabilis] Length = 750 Score = 106 bits (264), Expect = 4e-21 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 ++TP GS IR+ KN+RVCGDCH+AIKY+S + GREIIVRDT RFHHF NGSCSCGDYW Sbjct: 693 LNTPLGSTIRIKKNIRVCGDCHSAIKYVSKVVGREIIVRDTNRFHHFHNGSCSCGDYW 750 >ref|XP_004301739.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 669 Score = 106 bits (264), Expect = 4e-21 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I PSG+ IR+FKNLRVCGDCH+AIKYIS IE REII+RDTTRFH F+NG CSCGDYW Sbjct: 612 IHVPSGTPIRIFKNLRVCGDCHHAIKYISVIEKREIILRDTTRFHQFKNGVCSCGDYW 669 >ref|XP_004295338.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 650 Score = 106 bits (264), Expect = 4e-21 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 ++TP GS IR+ KN+RVCGDCH+AIKY+S +E REIIVRDT RFHHFR+GSCSCGDYW Sbjct: 593 LNTPPGSTIRIKKNIRVCGDCHSAIKYVSKVERREIIVRDTNRFHHFRDGSCSCGDYW 650 >ref|XP_007155703.1| hypothetical protein PHAVU_003G224100g [Phaseolus vulgaris] gi|561029057|gb|ESW27697.1| hypothetical protein PHAVU_003G224100g [Phaseolus vulgaris] Length = 643 Score = 105 bits (262), Expect = 6e-21 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 + PSG IRVFKNLRVCGDCH+A KYISAIEGREIIVRDT+RFHHF++G CSC DYW Sbjct: 586 LKVPSGVPIRVFKNLRVCGDCHSATKYISAIEGREIIVRDTSRFHHFKDGFCSCRDYW 643 >ref|XP_007210130.1| hypothetical protein PRUPE_ppa022577mg [Prunus persica] gi|462405865|gb|EMJ11329.1| hypothetical protein PRUPE_ppa022577mg [Prunus persica] Length = 569 Score = 105 bits (262), Expect = 6e-21 Identities = 46/58 (79%), Positives = 50/58 (86%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 I P G+ IR+FKNLRVCGDCH+A KYISAIE REIIVRDTTRFHHF+ G CSCGDYW Sbjct: 512 IKMPLGTPIRIFKNLRVCGDCHHATKYISAIEKREIIVRDTTRFHHFKGGVCSCGDYW 569 >ref|XP_004972826.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Setaria italica] Length = 508 Score = 105 bits (261), Expect = 8e-21 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 IS+P G +R+FKNLRVCGDCHNA K IS IE R+II+RDTTRFHHFR GSCSCGDYW Sbjct: 451 ISSPPGMTLRIFKNLRVCGDCHNAAKLISKIEDRKIILRDTTRFHHFRGGSCSCGDYW 508 >ref|XP_007214219.1| hypothetical protein PRUPE_ppa023254mg [Prunus persica] gi|462410084|gb|EMJ15418.1| hypothetical protein PRUPE_ppa023254mg [Prunus persica] Length = 563 Score = 105 bits (261), Expect = 8e-21 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = +1 Query: 1 ISTPSGSRIRVFKNLRVCGDCHNAIKYISAIEGREIIVRDTTRFHHFRNGSCSCGDYW 174 ++T GS IR+ KN+RVCGDCH+AIKY+S +EGREIIVRDT RFHHFRNGSCSC DYW Sbjct: 506 LNTTPGSTIRIKKNIRVCGDCHSAIKYVSKVEGREIIVRDTNRFHHFRNGSCSCRDYW 563