BLASTX nr result
ID: Akebia24_contig00038500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00038500 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT06293.1| Putative LRR receptor-like serine/threonine-prote... 58 1e-06 gb|EMT00328.1| Putative LRR receptor-like serine/threonine-prote... 58 1e-06 ref|XP_007131371.1| hypothetical protein PHAVU_011G008100g [Phas... 55 8e-06 >gb|EMT06293.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops tauschii] Length = 951 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +1 Query: 1 LIMLVTLNLSHNKLVGSIPPSLSDMVSLSSIDLSNNELRG 120 LIML TLNLSHNKL GSIPPS M SL+SID+S NEL G Sbjct: 513 LIMLDTLNLSHNKLNGSIPPSFQSMESLTSIDVSYNELEG 552 >gb|EMT00328.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops tauschii] Length = 1043 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +1 Query: 1 LIMLVTLNLSHNKLVGSIPPSLSDMVSLSSIDLSNNELRG 120 LIML TLNLSHNKL GSIPPS M SL+SID+S NEL G Sbjct: 513 LIMLDTLNLSHNKLNGSIPPSFQSMESLTSIDVSYNELEG 552 >ref|XP_007131371.1| hypothetical protein PHAVU_011G008100g [Phaseolus vulgaris] gi|561004371|gb|ESW03365.1| hypothetical protein PHAVU_011G008100g [Phaseolus vulgaris] Length = 941 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = +1 Query: 10 LVTLNLSHNKLVGSIPPSLSDMVSLSSIDLSNNELRGSSSNNADHKHLYKCLFPL 174 L+TLN+SHN L GSIP SL +++SLS IDLS+N L G N ++K FPL Sbjct: 513 LITLNISHNNLSGSIPHSLGELLSLSVIDLSHNNLEGPVPNGG----IFKSSFPL 563