BLASTX nr result
ID: Akebia24_contig00038487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00038487 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348959.1| PREDICTED: callose synthase 7-like [Solanum ... 127 4e-33 ref|XP_004243209.1| PREDICTED: callose synthase 7-like [Solanum ... 125 6e-33 ref|XP_002876489.1| hypothetical protein ARALYDRAFT_907409 [Arab... 127 1e-31 ref|XP_004139888.1| PREDICTED: callose synthase 7-like [Cucumis ... 125 1e-30 ref|XP_004159034.1| PREDICTED: LOW QUALITY PROTEIN: callose synt... 125 1e-30 ref|XP_002526651.1| transferase, transferring glycosyl groups, p... 134 1e-29 ref|XP_002300874.1| GLUCAN SYNTHASE-LIKE 11 family protein [Popu... 131 8e-29 ref|XP_006827367.1| hypothetical protein AMTR_s00011p00100920 [A... 129 3e-28 ref|XP_002889606.1| hypothetical protein ARALYDRAFT_470669 [Arab... 115 4e-28 ref|XP_007048880.1| Glucan synthase-like 7 [Theobroma cacao] gi|... 129 4e-28 ref|XP_002307554.1| GLUCAN SYNTHASE-LIKE 11 family protein [Popu... 129 4e-28 ref|NP_191469.3| putative callose synthase 6 [Arabidopsis thalia... 129 5e-28 emb|CAB86938.1| putative protein [Arabidopsis thaliana] 129 5e-28 ref|XP_006417911.1| hypothetical protein EUTSA_v10006529mg [Eutr... 113 2e-27 ref|NP_172136.2| callose synthase 7 [Arabidopsis thaliana] gi|33... 113 2e-27 gb|ADK87343.1| callose synthase 7 [Arabidopsis thaliana] 113 2e-27 gb|AAF24822.1|AC007592_15 F12K11.17 [Arabidopsis thaliana] 111 7e-27 ref|XP_006484915.1| PREDICTED: callose synthase 7-like isoform X... 125 8e-27 ref|XP_006484914.1| PREDICTED: callose synthase 7-like isoform X... 125 8e-27 ref|XP_006484913.1| PREDICTED: callose synthase 7-like isoform X... 125 8e-27 >ref|XP_006348959.1| PREDICTED: callose synthase 7-like [Solanum tuberosum] Length = 1911 Score = 127 bits (320), Expect(2) = 4e-33 Identities = 56/80 (70%), Positives = 63/80 (78%) Frame = -2 Query: 241 HA*ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPN 62 H + RNQ GTASHS WRNYDDLNEYFWSDKCFKLGWPM +ADFFVHS++++ + G N Sbjct: 401 HKESSRNQNGTASHSAWRNYDDLNEYFWSDKCFKLGWPMDKKADFFVHSDKRNKANVGHN 460 Query: 61 QPPTGKRKPKTNFVEVRTFW 2 TG RKPK NFVE RTFW Sbjct: 461 NVATGGRKPKANFVENRTFW 480 Score = 39.3 bits (90), Expect(2) = 4e-33 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -3 Query: 303 QPAHQGEESFLREVITPIYQVMRK 232 QP GEESFLR+V+TPIY+V+ K Sbjct: 379 QPVSHGEESFLRDVVTPIYEVIHK 402 >ref|XP_004243209.1| PREDICTED: callose synthase 7-like [Solanum lycopersicum] Length = 1912 Score = 125 bits (315), Expect(2) = 6e-33 Identities = 54/75 (72%), Positives = 61/75 (81%) Frame = -2 Query: 226 RNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPPTG 47 RN GTASHS WRNYDDLNEYFWSDKCFKLGWPM +ADFFVHS++++ + G N TG Sbjct: 406 RNLNGTASHSSWRNYDDLNEYFWSDKCFKLGWPMDKKADFFVHSDKRNTANVGHNNVATG 465 Query: 46 KRKPKTNFVEVRTFW 2 +RKPK NFVE RTFW Sbjct: 466 RRKPKANFVENRTFW 480 Score = 40.8 bits (94), Expect(2) = 6e-33 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -3 Query: 303 QPAHQGEESFLREVITPIYQVMRK 232 QP GEESFLR+V+TPIYQV++K Sbjct: 379 QPVSHGEESFLRDVVTPIYQVIQK 402 >ref|XP_002876489.1| hypothetical protein ARALYDRAFT_907409 [Arabidopsis lyrata subsp. lyrata] gi|297322327|gb|EFH52748.1| hypothetical protein ARALYDRAFT_907409 [Arabidopsis lyrata subsp. lyrata] Length = 1934 Score = 127 bits (318), Expect(2) = 1e-31 Identities = 55/77 (71%), Positives = 66/77 (85%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 ARRN+GGTASHS+WRNYDDLNEYFWS KCFK+GWP+ +ADFF++++E P++E NQ Sbjct: 408 ARRNKGGTASHSQWRNYDDLNEYFWSKKCFKIGWPLDLKADFFLNADEITPQNERLNQVT 467 Query: 52 TGKRKPKTNFVEVRTFW 2 GK KPKTNFVEVRTFW Sbjct: 468 YGKSKPKTNFVEVRTFW 484 Score = 35.4 bits (80), Expect(2) = 1e-31 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 285 EESFLREVITPIYQVMRK 232 EESFLR VITPIYQV+RK Sbjct: 389 EESFLRNVITPIYQVIRK 406 >ref|XP_004139888.1| PREDICTED: callose synthase 7-like [Cucumis sativus] Length = 1945 Score = 125 bits (314), Expect(2) = 1e-30 Identities = 54/76 (71%), Positives = 61/76 (80%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GG ASHS WRNYDDLNEYFWSD+CF LGWPM ++DFF HS+ P + PNQ Sbjct: 411 AKRNKGGKASHSTWRNYDDLNEYFWSDRCFNLGWPMNPKSDFFRHSDSIQPANANPNQVA 470 Query: 52 TGKRKPKTNFVEVRTF 5 GKRKPKTNFVEVRTF Sbjct: 471 AGKRKPKTNFVEVRTF 486 Score = 33.5 bits (75), Expect(2) = 1e-30 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 285 EESFLREVITPIYQVM 238 EESFLREV+TPIYQV+ Sbjct: 392 EESFLREVVTPIYQVL 407 >ref|XP_004159034.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 7-like [Cucumis sativus] Length = 1930 Score = 125 bits (314), Expect(2) = 1e-30 Identities = 54/76 (71%), Positives = 61/76 (80%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GG ASHS WRNYDDLNEYFWSD+CF LGWPM ++DFF HS+ P + PNQ Sbjct: 411 AKRNKGGKASHSTWRNYDDLNEYFWSDRCFNLGWPMNPKSDFFRHSDSIQPANANPNQVA 470 Query: 52 TGKRKPKTNFVEVRTF 5 GKRKPKTNFVEVRTF Sbjct: 471 AGKRKPKTNFVEVRTF 486 Score = 33.5 bits (75), Expect(2) = 1e-30 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 285 EESFLREVITPIYQVM 238 EESFLREV+TPIYQV+ Sbjct: 392 EESFLREVVTPIYQVL 407 >ref|XP_002526651.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223534018|gb|EEF35739.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1911 Score = 134 bits (337), Expect = 1e-29 Identities = 58/77 (75%), Positives = 67/77 (87%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GGTASHS+WRNYDDLNEYFWSDKCF+LGWPM +ADFFVHS+E +E NQ Sbjct: 411 AKRNKGGTASHSRWRNYDDLNEYFWSDKCFRLGWPMDLKADFFVHSDETPLINESSNQGV 470 Query: 52 TGKRKPKTNFVEVRTFW 2 +GKRKPKTNFVE+RTFW Sbjct: 471 SGKRKPKTNFVEIRTFW 487 >ref|XP_002300874.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] gi|222842600|gb|EEE80147.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] Length = 1940 Score = 131 bits (330), Expect = 8e-29 Identities = 60/77 (77%), Positives = 65/77 (84%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 ARRN+GG ASHSKWRNYDDLNEYFWSD+C KL WPM +ADFFVHS+E +E PNQ Sbjct: 410 ARRNKGGKASHSKWRNYDDLNEYFWSDRCLKLNWPMDLKADFFVHSDEIQRANERPNQ-S 468 Query: 52 TGKRKPKTNFVEVRTFW 2 TGKRKPKTNFVEVRTFW Sbjct: 469 TGKRKPKTNFVEVRTFW 485 >ref|XP_006827367.1| hypothetical protein AMTR_s00011p00100920 [Amborella trichopoda] gi|548831802|gb|ERM94604.1| hypothetical protein AMTR_s00011p00100920 [Amborella trichopoda] Length = 1916 Score = 129 bits (325), Expect = 3e-28 Identities = 57/77 (74%), Positives = 65/77 (84%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A++++GGTASHSKWRNYDDLNEYFWSDKCFK+GWPM E+DFFVHS E H KDE Sbjct: 406 AKKSKGGTASHSKWRNYDDLNEYFWSDKCFKIGWPMNLESDFFVHSRELHAKDERHFDQR 465 Query: 52 TGKRKPKTNFVEVRTFW 2 G+RKPKTNFVEVRTF+ Sbjct: 466 GGERKPKTNFVEVRTFF 482 >ref|XP_002889606.1| hypothetical protein ARALYDRAFT_470669 [Arabidopsis lyrata subsp. lyrata] gi|297335448|gb|EFH65865.1| hypothetical protein ARALYDRAFT_470669 [Arabidopsis lyrata subsp. lyrata] Length = 1937 Score = 115 bits (289), Expect(2) = 4e-28 Identities = 51/77 (66%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = -2 Query: 229 RRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHP-KDEGPNQPP 53 RRN+ G ASHSKWRNYDDLNEYFW ++CF+L WPM +ADFF+H++E P +E +Q Sbjct: 416 RRNKMGKASHSKWRNYDDLNEYFWDNRCFRLKWPMNSKADFFIHTDEISPLPNERHDQVS 475 Query: 52 TGKRKPKTNFVEVRTFW 2 GKRKPKTNFVE RTFW Sbjct: 476 HGKRKPKTNFVEARTFW 492 Score = 34.7 bits (78), Expect(2) = 4e-28 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 285 EESFLREVITPIYQVMRK 232 EE+FLR VITPIYQV+RK Sbjct: 396 EEAFLRNVITPIYQVLRK 413 >ref|XP_007048880.1| Glucan synthase-like 7 [Theobroma cacao] gi|508701141|gb|EOX93037.1| Glucan synthase-like 7 [Theobroma cacao] Length = 1929 Score = 129 bits (324), Expect = 4e-28 Identities = 56/77 (72%), Positives = 63/77 (81%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GG ASHS+WRNYDDLNEYFWS KCF+L WPM +ADFFVHS+E P +EG NQ Sbjct: 409 AKRNKGGKASHSQWRNYDDLNEYFWSRKCFRLKWPMDLKADFFVHSDEVPPANEGQNQAT 468 Query: 52 TGKRKPKTNFVEVRTFW 2 GKRKPK NFVE RTFW Sbjct: 469 VGKRKPKVNFVEARTFW 485 >ref|XP_002307554.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] gi|222857003|gb|EEE94550.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] Length = 1944 Score = 129 bits (324), Expect = 4e-28 Identities = 58/77 (75%), Positives = 62/77 (80%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 ARRN+GG ASHSKWRNYDDLNEYFWSDKC KL WPM A+FFVHS+E P +E NQ Sbjct: 409 ARRNKGGKASHSKWRNYDDLNEYFWSDKCLKLNWPMDLRANFFVHSDELPPANERSNQGT 468 Query: 52 TGKRKPKTNFVEVRTFW 2 G RKPKTNFVEVRTFW Sbjct: 469 GGTRKPKTNFVEVRTFW 485 >ref|NP_191469.3| putative callose synthase 6 [Arabidopsis thaliana] gi|189081840|sp|Q9LYS6.2|CALS6_ARATH RecName: Full=Putative callose synthase 6; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 11 gi|332646357|gb|AEE79878.1| putative callose synthase 6 [Arabidopsis thaliana] Length = 1921 Score = 129 bits (323), Expect = 5e-28 Identities = 56/77 (72%), Positives = 66/77 (85%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GGTASHS+WRNYDDLNEYFWS KCFK+GWP+ +ADFF++S+E P+DE NQ Sbjct: 408 AKRNKGGTASHSQWRNYDDLNEYFWSKKCFKIGWPLDLKADFFLNSDEITPQDERLNQVT 467 Query: 52 TGKRKPKTNFVEVRTFW 2 GK KPKTNFVEVRTFW Sbjct: 468 YGKSKPKTNFVEVRTFW 484 >emb|CAB86938.1| putative protein [Arabidopsis thaliana] Length = 1808 Score = 129 bits (323), Expect = 5e-28 Identities = 56/77 (72%), Positives = 66/77 (85%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GGTASHS+WRNYDDLNEYFWS KCFK+GWP+ +ADFF++S+E P+DE NQ Sbjct: 406 AKRNKGGTASHSQWRNYDDLNEYFWSKKCFKIGWPLDLKADFFLNSDEITPQDERLNQVT 465 Query: 52 TGKRKPKTNFVEVRTFW 2 GK KPKTNFVEVRTFW Sbjct: 466 YGKSKPKTNFVEVRTFW 482 >ref|XP_006417911.1| hypothetical protein EUTSA_v10006529mg [Eutrema salsugineum] gi|557095682|gb|ESQ36264.1| hypothetical protein EUTSA_v10006529mg [Eutrema salsugineum] Length = 1934 Score = 113 bits (283), Expect(2) = 2e-27 Identities = 51/77 (66%), Positives = 59/77 (76%), Gaps = 1/77 (1%) Frame = -2 Query: 229 RRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEE-KHPKDEGPNQPP 53 RRN+ G ASHSKWRNYDDLNEYFW +CF+L WPM +ADFF+HS+E +E +Q Sbjct: 416 RRNKMGKASHSKWRNYDDLNEYFWDKRCFRLKWPMNFKADFFIHSDEISQFPNERHDQVS 475 Query: 52 TGKRKPKTNFVEVRTFW 2 GKRKPKTNFVE RTFW Sbjct: 476 YGKRKPKTNFVEARTFW 492 Score = 34.7 bits (78), Expect(2) = 2e-27 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 285 EESFLREVITPIYQVMRK 232 EE+FLR VITPIYQV+RK Sbjct: 396 EEAFLRNVITPIYQVLRK 413 >ref|NP_172136.2| callose synthase 7 [Arabidopsis thaliana] gi|334302882|sp|Q9SHJ3.3|CALS7_ARATH RecName: Full=Callose synthase 7; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 7 gi|332189872|gb|AEE27993.1| callose synthase 7 [Arabidopsis thaliana] Length = 1958 Score = 113 bits (282), Expect(2) = 2e-27 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%) Frame = -2 Query: 229 RRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEE-KHPKDEGPNQPP 53 RRN+ G ASHSKWRNYDDLNEYFW +CF+L WPM +ADFF+H++E ++ +Q Sbjct: 417 RRNKNGKASHSKWRNYDDLNEYFWDKRCFRLKWPMNFKADFFIHTDEISQVPNQRHDQVS 476 Query: 52 TGKRKPKTNFVEVRTFW 2 GKRKPKTNFVE RTFW Sbjct: 477 HGKRKPKTNFVEARTFW 493 Score = 34.7 bits (78), Expect(2) = 2e-27 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 285 EESFLREVITPIYQVMRK 232 EE+FLR VITPIYQV+RK Sbjct: 397 EEAFLRNVITPIYQVLRK 414 >gb|ADK87343.1| callose synthase 7 [Arabidopsis thaliana] Length = 1933 Score = 113 bits (282), Expect(2) = 2e-27 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%) Frame = -2 Query: 229 RRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEE-KHPKDEGPNQPP 53 RRN+ G ASHSKWRNYDDLNEYFW +CF+L WPM +ADFF+H++E ++ +Q Sbjct: 417 RRNKNGKASHSKWRNYDDLNEYFWDKRCFRLKWPMNFKADFFIHTDEISQVPNQRHDQVS 476 Query: 52 TGKRKPKTNFVEVRTFW 2 GKRKPKTNFVE RTFW Sbjct: 477 HGKRKPKTNFVEARTFW 493 Score = 34.7 bits (78), Expect(2) = 2e-27 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 285 EESFLREVITPIYQVMRK 232 EE+FLR VITPIYQV+RK Sbjct: 397 EEAFLRNVITPIYQVLRK 414 >gb|AAF24822.1|AC007592_15 F12K11.17 [Arabidopsis thaliana] Length = 1930 Score = 111 bits (278), Expect(2) = 7e-27 Identities = 48/77 (62%), Positives = 59/77 (76%), Gaps = 1/77 (1%) Frame = -2 Query: 229 RRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEE-KHPKDEGPNQPP 53 +RN+ G ASHSKWRNYDDLNEYFW +CF+L WPM +ADFF+H++E ++ +Q Sbjct: 414 QRNKNGKASHSKWRNYDDLNEYFWDKRCFRLKWPMNFKADFFIHTDEISQVPNQRHDQVS 473 Query: 52 TGKRKPKTNFVEVRTFW 2 GKRKPKTNFVE RTFW Sbjct: 474 HGKRKPKTNFVEARTFW 490 Score = 34.7 bits (78), Expect(2) = 7e-27 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 285 EESFLREVITPIYQVMRK 232 EE+FLR VITPIYQV+RK Sbjct: 390 EEAFLRNVITPIYQVLRK 407 >ref|XP_006484915.1| PREDICTED: callose synthase 7-like isoform X4 [Citrus sinensis] Length = 1904 Score = 125 bits (313), Expect = 8e-27 Identities = 55/77 (71%), Positives = 60/77 (77%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GG ASHS+WRNYDDLNEYFWS KCF L WPM +ADFFVHS+ P E PNQ P Sbjct: 410 AKRNKGGKASHSRWRNYDDLNEYFWSRKCFSLKWPMDPKADFFVHSDVVLPSHERPNQVP 469 Query: 52 TGKRKPKTNFVEVRTFW 2 RKPKTNFVE RTFW Sbjct: 470 AETRKPKTNFVEARTFW 486 >ref|XP_006484914.1| PREDICTED: callose synthase 7-like isoform X3 [Citrus sinensis] Length = 1535 Score = 125 bits (313), Expect = 8e-27 Identities = 55/77 (71%), Positives = 60/77 (77%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GG ASHS+WRNYDDLNEYFWS KCF L WPM +ADFFVHS+ P E PNQ P Sbjct: 50 AKRNKGGKASHSRWRNYDDLNEYFWSRKCFSLKWPMDPKADFFVHSDVVLPSHERPNQVP 109 Query: 52 TGKRKPKTNFVEVRTFW 2 RKPKTNFVE RTFW Sbjct: 110 AETRKPKTNFVEARTFW 126 >ref|XP_006484913.1| PREDICTED: callose synthase 7-like isoform X2 [Citrus sinensis] Length = 1544 Score = 125 bits (313), Expect = 8e-27 Identities = 55/77 (71%), Positives = 60/77 (77%) Frame = -2 Query: 232 ARRNQGGTASHSKWRNYDDLNEYFWSDKCFKLGWPMKHEADFFVHSEEKHPKDEGPNQPP 53 A+RN+GG ASHS+WRNYDDLNEYFWS KCF L WPM +ADFFVHS+ P E PNQ P Sbjct: 50 AKRNKGGKASHSRWRNYDDLNEYFWSRKCFSLKWPMDPKADFFVHSDVVLPSHERPNQVP 109 Query: 52 TGKRKPKTNFVEVRTFW 2 RKPKTNFVE RTFW Sbjct: 110 AETRKPKTNFVEARTFW 126