BLASTX nr result
ID: Akebia24_contig00038296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00038296 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310498.1| hypothetical protein POPTR_0007s03580g [Popu... 123 3e-26 ref|XP_007041122.1| Temperature sensing protein-related [Theobro... 118 8e-25 ref|XP_002276138.1| PREDICTED: cell division cycle protein 123 h... 117 1e-24 emb|CAN76115.1| hypothetical protein VITISV_026936 [Vitis vinifera] 117 1e-24 ref|XP_003544043.1| PREDICTED: cell division cycle protein 123 h... 115 8e-24 ref|XP_007215632.1| hypothetical protein PRUPE_ppa008083mg [Prun... 113 2e-23 ref|XP_002274599.1| PREDICTED: cell division cycle protein 123 h... 113 3e-23 ref|XP_006373038.1| hypothetical protein POPTR_0017s07590g [Popu... 111 9e-23 ref|XP_007138533.1| hypothetical protein PHAVU_009G217100g [Phas... 111 1e-22 gb|EYU37632.1| hypothetical protein MIMGU_mgv1a009554mg [Mimulus... 110 2e-22 gb|AFK43861.1| unknown [Lotus japonicus] 110 2e-22 ref|XP_002522614.1| Cell division cycle protein, putative [Ricin... 110 2e-22 ref|XP_006448952.1| hypothetical protein CICLE_v10015850mg [Citr... 110 2e-22 ref|XP_006448951.1| hypothetical protein CICLE_v10015850mg [Citr... 110 2e-22 ref|XP_003605701.1| Cell division cycle protein-like protein [Me... 109 3e-22 gb|EXC25621.1| hypothetical protein L484_009926 [Morus notabilis] 109 5e-22 ref|XP_006468271.1| PREDICTED: cell division cycle protein 123 h... 108 6e-22 ref|XP_006346366.1| PREDICTED: cell division cycle protein 123 h... 108 1e-21 ref|XP_004488280.1| PREDICTED: cell division cycle protein 123 h... 108 1e-21 ref|XP_007222315.1| hypothetical protein PRUPE_ppa008054mg [Prun... 108 1e-21 >ref|XP_002310498.1| hypothetical protein POPTR_0007s03580g [Populus trichocarpa] gi|222853401|gb|EEE90948.1| hypothetical protein POPTR_0007s03580g [Populus trichocarpa] Length = 336 Score = 123 bits (308), Expect = 3e-26 Identities = 57/75 (76%), Positives = 67/75 (89%) Frame = -3 Query: 227 PEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYTFD 48 PEMEFRCFV+ Q LVGISQRE+T FYP LLE+K+DLE+ I++FF ENV+QKFESE YTFD Sbjct: 181 PEMEFRCFVRGQQLVGISQREVTTFYPTLLEEKNDLELLIKEFFTENVRQKFESENYTFD 240 Query: 47 VYVTKDGRIKLVDFN 3 VYVTKDGR K++DFN Sbjct: 241 VYVTKDGRAKILDFN 255 >ref|XP_007041122.1| Temperature sensing protein-related [Theobroma cacao] gi|508705057|gb|EOX96953.1| Temperature sensing protein-related [Theobroma cacao] Length = 334 Score = 118 bits (296), Expect = 8e-25 Identities = 54/77 (70%), Positives = 68/77 (88%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFVQ Q LVG+SQRE+T FYPVL EKK+DLE+ +++FF +NV+ +FESE+YT Sbjct: 178 LRPEMEFRCFVQGQHLVGVSQREVTTFYPVLCEKKNDLEMLVKEFFNDNVRLQFESEDYT 237 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVTKD R+K++DFN Sbjct: 238 FDVYVTKDERVKVLDFN 254 >ref|XP_002276138.1| PREDICTED: cell division cycle protein 123 homolog [Vitis vinifera] Length = 385 Score = 117 bits (294), Expect = 1e-24 Identities = 56/77 (72%), Positives = 63/77 (81%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ +LLVGISQRE+TGFYP LLEKK LE+ IR+FF + V Q FE E YT Sbjct: 179 LRPEMEFRCFVRDRLLVGISQREVTGFYPALLEKKSALEVVIREFFMDKVSQTFELENYT 238 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVT D R+KLVDFN Sbjct: 239 FDVYVTMDDRVKLVDFN 255 >emb|CAN76115.1| hypothetical protein VITISV_026936 [Vitis vinifera] Length = 336 Score = 117 bits (294), Expect = 1e-24 Identities = 56/77 (72%), Positives = 63/77 (81%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ +LLVGISQRE+TGFYP LLEKK LE+ IR+FF + V Q FE E YT Sbjct: 179 LRPEMEFRCFVRDRLLVGISQREVTGFYPALLEKKSALEVVIREFFMDKVSQTFELENYT 238 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVT D R+KLVDFN Sbjct: 239 FDVYVTMDDRVKLVDFN 255 >ref|XP_003544043.1| PREDICTED: cell division cycle protein 123 homolog isoform X1 [Glycine max] gi|571507404|ref|XP_006595850.1| PREDICTED: cell division cycle protein 123 homolog isoform X2 [Glycine max] Length = 332 Score = 115 bits (287), Expect = 8e-24 Identities = 53/77 (68%), Positives = 64/77 (83%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L P+MEFRCFV+ Q L+GISQRE+T FYPVLLEKK+DL I+ FF +V+ KFESE YT Sbjct: 178 LQPDMEFRCFVRNQKLIGISQREVTTFYPVLLEKKNDLLFLIQAFFINHVRAKFESENYT 237 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVY+TKD R+K+VDFN Sbjct: 238 FDVYITKDDRVKIVDFN 254 >ref|XP_007215632.1| hypothetical protein PRUPE_ppa008083mg [Prunus persica] gi|462411782|gb|EMJ16831.1| hypothetical protein PRUPE_ppa008083mg [Prunus persica] Length = 346 Score = 113 bits (283), Expect = 2e-23 Identities = 53/77 (68%), Positives = 61/77 (79%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ Q LVGISQRE+T FYP LLEKK L + I FF EN+ +FESE YT Sbjct: 188 LKPEMEFRCFVRNQNLVGISQREVTTFYPALLEKKDSLRVLIEDFFVENLMSRFESENYT 247 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVT+D R+K+VDFN Sbjct: 248 FDVYVTEDDRVKVVDFN 264 >ref|XP_002274599.1| PREDICTED: cell division cycle protein 123 homolog [Vitis vinifera] Length = 338 Score = 113 bits (282), Expect = 3e-23 Identities = 54/77 (70%), Positives = 61/77 (79%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ LVGISQRE+TGFYP LLEKK+DLE+ IR+FF + V FE YT Sbjct: 179 LRPEMEFRCFVRDGCLVGISQREVTGFYPGLLEKKNDLEVVIRQFFLDKVSPSFELANYT 238 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYV KD R+KLVDFN Sbjct: 239 FDVYVKKDDRVKLVDFN 255 >ref|XP_006373038.1| hypothetical protein POPTR_0017s07590g [Populus trichocarpa] gi|550319713|gb|ERP50835.1| hypothetical protein POPTR_0017s07590g [Populus trichocarpa] Length = 336 Score = 111 bits (278), Expect = 9e-23 Identities = 53/75 (70%), Positives = 62/75 (82%) Frame = -3 Query: 227 PEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYTFD 48 PEMEFRCFV+ + LVGISQRE+T FYP LLEKK+DL I +FF +NV+ KFESE YTFD Sbjct: 181 PEMEFRCFVRDKQLVGISQREVTTFYPTLLEKKNDLLWLIEEFFTDNVRLKFESENYTFD 240 Query: 47 VYVTKDGRIKLVDFN 3 VYV KDGR K++DFN Sbjct: 241 VYVMKDGRAKILDFN 255 >ref|XP_007138533.1| hypothetical protein PHAVU_009G217100g [Phaseolus vulgaris] gi|593330215|ref|XP_007138534.1| hypothetical protein PHAVU_009G217100g [Phaseolus vulgaris] gi|561011620|gb|ESW10527.1| hypothetical protein PHAVU_009G217100g [Phaseolus vulgaris] gi|561011621|gb|ESW10528.1| hypothetical protein PHAVU_009G217100g [Phaseolus vulgaris] Length = 332 Score = 111 bits (277), Expect = 1e-22 Identities = 52/77 (67%), Positives = 63/77 (81%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L P+MEFRCF++ Q L+GISQRE+T FYPVLLEKK+DL I FF +V+ KFESE YT Sbjct: 178 LQPDMEFRCFIRDQKLIGISQREVTTFYPVLLEKKNDLLSLILAFFNNHVRAKFESENYT 237 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVY+TKD R+K+VDFN Sbjct: 238 FDVYITKDERVKVVDFN 254 >gb|EYU37632.1| hypothetical protein MIMGU_mgv1a009554mg [Mimulus guttatus] gi|604333282|gb|EYU37633.1| hypothetical protein MIMGU_mgv1a009554mg [Mimulus guttatus] Length = 338 Score = 110 bits (276), Expect = 2e-22 Identities = 52/77 (67%), Positives = 61/77 (79%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV +LLVGI QRE+T FYP LLE+K DL+ I FF E V+ KF SE +T Sbjct: 179 LQPEMEFRCFVLNKLLVGICQREVTNFYPTLLERKSDLKAMILDFFVEEVKGKFGSESFT 238 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVTKDGR+K++DFN Sbjct: 239 FDVYVTKDGRVKVLDFN 255 >gb|AFK43861.1| unknown [Lotus japonicus] Length = 335 Score = 110 bits (276), Expect = 2e-22 Identities = 51/77 (66%), Positives = 65/77 (84%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L P+MEFRCFV++Q LVGISQRE+T FYP+LLEKK+DL + ++ FF V+ +FESE YT Sbjct: 179 LKPDMEFRCFVREQKLVGISQREVTTFYPILLEKKNDLLLLMQGFFNNYVRTRFESENYT 238 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVY+TKD R+K+VDFN Sbjct: 239 FDVYITKDERVKVVDFN 255 >ref|XP_002522614.1| Cell division cycle protein, putative [Ricinus communis] gi|223538090|gb|EEF39701.1| Cell division cycle protein, putative [Ricinus communis] Length = 337 Score = 110 bits (276), Expect = 2e-22 Identities = 53/77 (68%), Positives = 62/77 (80%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV LVGISQRE+T YP+LLEKK DL++ I +FF +NV+ KFESE YT Sbjct: 179 LLPEMEFRCFVWGNRLVGISQREVTTCYPILLEKKTDLQLLIEEFFLDNVRMKFESENYT 238 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYV KD R+K+VDFN Sbjct: 239 FDVYVMKDERVKIVDFN 255 >ref|XP_006448952.1| hypothetical protein CICLE_v10015850mg [Citrus clementina] gi|557551563|gb|ESR62192.1| hypothetical protein CICLE_v10015850mg [Citrus clementina] Length = 338 Score = 110 bits (275), Expect = 2e-22 Identities = 51/77 (66%), Positives = 64/77 (83%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ Q LVGISQRE+T YP L EKK+D+++ I++ F NV+Q+FESE YT Sbjct: 181 LRPEMEFRCFVRGQCLVGISQREVTMCYPALSEKKNDIKVLIQELFDSNVRQEFESENYT 240 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVTKD R+K++DFN Sbjct: 241 FDVYVTKDERVKILDFN 257 >ref|XP_006448951.1| hypothetical protein CICLE_v10015850mg [Citrus clementina] gi|557551562|gb|ESR62191.1| hypothetical protein CICLE_v10015850mg [Citrus clementina] Length = 335 Score = 110 bits (275), Expect = 2e-22 Identities = 51/77 (66%), Positives = 64/77 (83%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ Q LVGISQRE+T YP L EKK+D+++ I++ F NV+Q+FESE YT Sbjct: 178 LRPEMEFRCFVRGQCLVGISQREVTMCYPALSEKKNDIKVLIQELFDSNVRQEFESENYT 237 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVTKD R+K++DFN Sbjct: 238 FDVYVTKDERVKILDFN 254 >ref|XP_003605701.1| Cell division cycle protein-like protein [Medicago truncatula] gi|355506756|gb|AES87898.1| Cell division cycle protein-like protein [Medicago truncatula] Length = 338 Score = 109 bits (273), Expect = 3e-22 Identities = 51/77 (66%), Positives = 62/77 (80%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ Q LVGISQRE+T FYP+LLEKK+ L + I+ FF +V+ KFESE Y Sbjct: 182 LKPEMEFRCFVRNQKLVGISQREVTTFYPILLEKKNGLLLQIQGFFNNHVRTKFESENYV 241 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVY+T D R+K+VDFN Sbjct: 242 FDVYITNDERVKIVDFN 258 >gb|EXC25621.1| hypothetical protein L484_009926 [Morus notabilis] Length = 324 Score = 109 bits (272), Expect = 5e-22 Identities = 48/77 (62%), Positives = 64/77 (83%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L P+MEFRCFV+ + L+GISQRE+T FYP L+EKK ++ +R+FFAENV+++FES YT Sbjct: 167 LRPDMEFRCFVKNRNLIGISQREVTTFYPALVEKKDEIRALVRRFFAENVRERFESVNYT 226 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVT D ++K+VDFN Sbjct: 227 FDVYVTGDEKVKVVDFN 243 >ref|XP_006468271.1| PREDICTED: cell division cycle protein 123 homolog [Citrus sinensis] Length = 338 Score = 108 bits (271), Expect = 6e-22 Identities = 50/77 (64%), Positives = 64/77 (83%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ + LVGISQRE+T YP L EKK+D+++ I++ F NV+Q+FESE YT Sbjct: 181 LRPEMEFRCFVRGRCLVGISQREVTMCYPALSEKKNDIKVLIQELFDSNVRQEFESENYT 240 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVTKD R+K++DFN Sbjct: 241 FDVYVTKDERVKILDFN 257 >ref|XP_006346366.1| PREDICTED: cell division cycle protein 123 homolog [Solanum tuberosum] Length = 336 Score = 108 bits (269), Expect = 1e-21 Identities = 49/77 (63%), Positives = 61/77 (79%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEMEFRCFV+ +LVG+SQRE+TGFYP L+EKK +L I++FF V+ FESE YT Sbjct: 179 LRPEMEFRCFVRNGILVGVSQREVTGFYPALVEKKDELITIIQRFFIYKVKGNFESESYT 238 Query: 53 FDVYVTKDGRIKLVDFN 3 FD+YVT D R+KL+DFN Sbjct: 239 FDIYVTNDDRVKLLDFN 255 >ref|XP_004488280.1| PREDICTED: cell division cycle protein 123 homolog [Cicer arietinum] Length = 336 Score = 108 bits (269), Expect = 1e-21 Identities = 51/77 (66%), Positives = 63/77 (81%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L+P+MEFRCFV LVGISQRE+T FYPVLLEKK+D+ I+ FF +V+ KFESE YT Sbjct: 179 LNPDMEFRCFVWNDKLVGISQREVTTFYPVLLEKKNDILSLIQGFFNNHVRAKFESENYT 238 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVY+TK+ R+K+VDFN Sbjct: 239 FDVYITKNERVKIVDFN 255 >ref|XP_007222315.1| hypothetical protein PRUPE_ppa008054mg [Prunus persica] gi|462419251|gb|EMJ23514.1| hypothetical protein PRUPE_ppa008054mg [Prunus persica] Length = 347 Score = 108 bits (269), Expect = 1e-21 Identities = 51/77 (66%), Positives = 59/77 (76%) Frame = -3 Query: 233 LHPEMEFRCFVQKQLLVGISQREITGFYPVLLEKKHDLEISIRKFFAENVQQKFESEEYT 54 L PEME RCFV+ Q LVGISQRE+T FYP LLEKK L + I FF EN+ +FE E YT Sbjct: 189 LKPEMELRCFVRNQNLVGISQREVTTFYPALLEKKDSLPVLIEDFFVENLMSRFELENYT 248 Query: 53 FDVYVTKDGRIKLVDFN 3 FDVYVT+D RIK++DFN Sbjct: 249 FDVYVTEDNRIKVLDFN 265