BLASTX nr result
ID: Akebia24_contig00038287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00038287 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237912.1| PREDICTED: putative pentatricopeptide repeat... 83 5e-14 ref|XP_006364856.1| PREDICTED: putative pentatricopeptide repeat... 82 1e-13 gb|EXB42572.1| Putative pentatricopeptide repeat-containing prot... 79 5e-13 ref|XP_002520265.1| pentatricopeptide repeat-containing protein,... 76 6e-12 ref|XP_004299926.1| PREDICTED: putative pentatricopeptide repeat... 73 4e-11 ref|XP_002302206.2| pentatricopeptide repeat-containing family p... 72 8e-11 gb|EPS66240.1| hypothetical protein M569_08541 [Genlisea aurea] 70 3e-10 ref|XP_006473032.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_007019279.1| Pentatricopeptide repeat (PPR) superfamily p... 67 3e-09 emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] 66 6e-09 emb|CBI19925.3| unnamed protein product [Vitis vinifera] 65 7e-09 ref|XP_002279169.1| PREDICTED: putative pentatricopeptide repeat... 65 7e-09 ref|XP_006434327.1| hypothetical protein CICLE_v10000495mg [Citr... 65 1e-08 ref|XP_002963777.1| hypothetical protein SELMODRAFT_79925 [Selag... 57 3e-06 >ref|XP_004237912.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial-like isoform 1 [Solanum lycopersicum] gi|460384427|ref|XP_004237913.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 685 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/66 (60%), Positives = 52/66 (78%) Frame = +2 Query: 14 MDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDA 193 M+LDL SCARLL + +++ S+ GKQ+HL+ LKRG+L SA I N LLQMY RCG+++DA Sbjct: 1 MELDLQSCARLLNTVNSNQSLPNGKQLHLVFLKRGILNSALTIANRLLQMYTRCGQMADA 60 Query: 194 QCLFDE 211 Q LFDE Sbjct: 61 QLLFDE 66 >ref|XP_006364856.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial-like [Solanum tuberosum] Length = 685 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/66 (59%), Positives = 52/66 (78%) Frame = +2 Query: 14 MDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDA 193 M+LDL SCARLL + +++ S+ GKQ+HL+ LKRG+L SA I N LLQMY RCG+++DA Sbjct: 1 MELDLQSCARLLNTVNSNQSLPNGKQLHLVFLKRGILNSALTIANRLLQMYTRCGQMADA 60 Query: 194 QCLFDE 211 + LFDE Sbjct: 61 ELLFDE 66 >gb|EXB42572.1| Putative pentatricopeptide repeat-containing protein [Morus notabilis] Length = 951 Score = 79.3 bits (194), Expect = 5e-13 Identities = 41/68 (60%), Positives = 50/68 (73%) Frame = +2 Query: 8 FIMDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLS 187 F M+ D+ S RLL+S +TH SI +GKQ+HLL LK+GLL S IGN LLQMY+RCG S Sbjct: 35 FSMNPDVYSLVRLLQSCNTHQSIHQGKQLHLLFLKKGLLGSDVTIGNRLLQMYLRCGSTS 94 Query: 188 DAQCLFDE 211 DA LF+E Sbjct: 95 DAHALFEE 102 >ref|XP_002520265.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540484|gb|EEF42051.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 681 Score = 75.9 bits (185), Expect = 6e-12 Identities = 39/67 (58%), Positives = 50/67 (74%), Gaps = 1/67 (1%) Frame = +2 Query: 14 MDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRC-GRLSD 190 MDL+L S ARLL+S +TH SI +GKQ+HLL LK+GL+ + + N LLQMY RC G ++D Sbjct: 1 MDLELRSLARLLQSLNTHSSIHQGKQLHLLFLKKGLINATVSLANRLLQMYARCGGTMTD 60 Query: 191 AQCLFDE 211 A LFDE Sbjct: 61 AHNLFDE 67 >ref|XP_004299926.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 682 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = +2 Query: 14 MDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDA 193 M+L+L S +L S +TH S+ GKQ+HL LK+GL+ S IGN LLQMY++CG + DA Sbjct: 1 MNLELHSLVNILHSCNTHLSLYLGKQLHLTFLKKGLINSTVTIGNRLLQMYVKCGTMDDA 60 Query: 194 QCLFDE 211 LFDE Sbjct: 61 LNLFDE 66 >ref|XP_002302206.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344485|gb|EEE81479.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 681 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/66 (53%), Positives = 48/66 (72%) Frame = +2 Query: 14 MDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDA 193 MDLDL + AR L+S +T SI +GKQ+H+L K+GL++S + N LLQMY RCG +++A Sbjct: 1 MDLDLQNLARFLQSLNTPHSIHQGKQLHILFFKKGLIQSTLSLANRLLQMYTRCGSMTNA 60 Query: 194 QCLFDE 211 LFDE Sbjct: 61 HKLFDE 66 >gb|EPS66240.1| hypothetical protein M569_08541 [Genlisea aurea] Length = 690 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/58 (58%), Positives = 41/58 (70%) Frame = +2 Query: 38 ARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDAQCLFDE 211 ARLL SFD + +GKQ+HLL LKRG L S I N LLQMY +CG++ DA+ LFDE Sbjct: 11 ARLLNSFDVPSLVCRGKQLHLLFLKRGALFSTVSIANRLLQMYAKCGKMKDARVLFDE 68 >ref|XP_006473032.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Citrus sinensis] Length = 1390 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/66 (56%), Positives = 45/66 (68%) Frame = +2 Query: 14 MDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDA 193 MD + ARLL+S +TH SI GKQ+HL LK+G+L S I N LLQMY+RCG +DA Sbjct: 710 MDTSIDYLARLLQSCNTHHSIHVGKQLHLHFLKKGILNSTLPIANRLLQMYMRCGNPTDA 769 Query: 194 QCLFDE 211 LFDE Sbjct: 770 LLLFDE 775 >ref|XP_007019279.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508724607|gb|EOY16504.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 675 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/66 (51%), Positives = 45/66 (68%) Frame = +2 Query: 14 MDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDA 193 M+LDL + AR+L+S +TH IL GKQ+H LK+G+L S IGN LLQ+Y RC ++ Sbjct: 1 MELDLQNYARILQSCNTHNFILLGKQLHSFFLKKGILSSTITIGNRLLQLYSRCSTTTET 60 Query: 194 QCLFDE 211 LFDE Sbjct: 61 WKLFDE 66 >emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] Length = 1796 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/67 (50%), Positives = 46/67 (68%) Frame = +2 Query: 11 IMDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSD 190 ++DLDL S AR L S + + SI +G+ +H+L LK G+L S IGN LLQMY RC + + Sbjct: 1 MVDLDLHSLARQLGSCNNYGSIYRGRXLHILFLKSGVLHSVLSIGNRLLQMYSRCNSMRE 60 Query: 191 AQCLFDE 211 AQ LF+E Sbjct: 61 AQQLFEE 67 >emb|CBI19925.3| unnamed protein product [Vitis vinifera] Length = 581 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/67 (50%), Positives = 46/67 (68%) Frame = +2 Query: 11 IMDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSD 190 ++DLDL S AR L S + + SI +G+ +H+L LK G+L S IGN LLQMY RC + + Sbjct: 37 MVDLDLHSLARQLGSCNNYGSIYRGRLLHILFLKSGVLHSVLSIGNRLLQMYSRCNSMRE 96 Query: 191 AQCLFDE 211 AQ LF+E Sbjct: 97 AQQLFEE 103 >ref|XP_002279169.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial-like [Vitis vinifera] Length = 685 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/67 (50%), Positives = 46/67 (68%) Frame = +2 Query: 11 IMDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSD 190 ++DLDL S AR L S + + SI +G+ +H+L LK G+L S IGN LLQMY RC + + Sbjct: 1 MVDLDLHSLARQLGSCNNYGSIYRGRLLHILFLKSGVLHSVLSIGNRLLQMYSRCNSMRE 60 Query: 191 AQCLFDE 211 AQ LF+E Sbjct: 61 AQQLFEE 67 >ref|XP_006434327.1| hypothetical protein CICLE_v10000495mg [Citrus clementina] gi|557536449|gb|ESR47567.1| hypothetical protein CICLE_v10000495mg [Citrus clementina] Length = 681 Score = 65.1 bits (157), Expect = 1e-08 Identities = 36/66 (54%), Positives = 44/66 (66%) Frame = +2 Query: 14 MDLDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDA 193 MD + ARLL+S +TH SI GKQ+HL LK+G+L S I N LL MY+RCG +DA Sbjct: 1 MDTRIDYLARLLQSCNTHHSIHVGKQLHLHFLKKGILNSTLPIANRLLLMYMRCGNPTDA 60 Query: 194 QCLFDE 211 LFDE Sbjct: 61 LLLFDE 66 >ref|XP_002963777.1| hypothetical protein SELMODRAFT_79925 [Selaginella moellendorffii] gi|300169045|gb|EFJ35648.1| hypothetical protein SELMODRAFT_79925 [Selaginella moellendorffii] Length = 437 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/63 (42%), Positives = 41/63 (65%) Frame = +2 Query: 20 LDLLSCARLLRSFDTHCSILKGKQIHLLLLKRGLLESAPFIGNYLLQMYIRCGRLSDAQC 199 L+L CA LLR F + S+ +G+Q+H LL + G + F+GN L+QMY CG + +A+ Sbjct: 23 LELKRCAELLRQFGSARSLSRGRQLHSLLARHGRRDRERFVGNLLVQMYGSCGSVIEARE 82 Query: 200 LFD 208 +FD Sbjct: 83 VFD 85