BLASTX nr result
ID: Akebia24_contig00036004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00036004 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361496.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_006361496.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Solanum tuberosum] Length = 702 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/61 (39%), Positives = 39/61 (63%) Frame = -1 Query: 188 NFDVHKTNRLREVGVKSNGFHETHKMFDEMSQKNVISWTAMISKNAKLGLNERALGYFSQ 9 N D+ N L + +K N + ++FD M ++N+ISWT +IS ++LG++E+ALG F Sbjct: 33 NADIFTNNHLLTMYLKLNQLDDAQQLFDRMPERNIISWTTLISTYSQLGMSEKALGCFRS 92 Query: 8 M 6 M Sbjct: 93 M 93