BLASTX nr result
ID: Akebia24_contig00035254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00035254 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512772.1| serine/threonine protein kinase, putative [R... 56 5e-06 >ref|XP_002512772.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223547783|gb|EEF49275.1| serine/threonine protein kinase, putative [Ricinus communis] Length = 701 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 14/88 (15%) Frame = -3 Query: 224 DNLVNLTKQACLADIPASRAADGGRV--SAAAIEKSL------------IDXXXXXXXXX 87 DN++NL KQ C D PASRA DGG + A + E SL ++ Sbjct: 603 DNILNLMKQVCGCDTPASRAIDGGSILSIAGSTENSLMINESTSGFLDRLEAAHDREKDL 662 Query: 86 KQEVAELRWSLKCAHEEIERLKLQNTQV 3 E+ EL+W L CA EE+++ + +N Q+ Sbjct: 663 LHEITELQWRLLCAQEELKKYRTENAQI 690