BLASTX nr result
ID: Akebia24_contig00034874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00034874 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844850.1| hypothetical protein AMTR_s00058p00097500 [A... 56 6e-06 ref|XP_002528440.1| Disease resistance protein RPP8, putative [R... 55 8e-06 >ref|XP_006844850.1| hypothetical protein AMTR_s00058p00097500 [Amborella trichopoda] gi|548847341|gb|ERN06525.1| hypothetical protein AMTR_s00058p00097500 [Amborella trichopoda] Length = 895 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/69 (40%), Positives = 42/69 (60%) Frame = -3 Query: 210 AEALVKSAITKLKDLAIEEWQIQRGISNDINFISNEFSMMKAVIRKAEKRRVRDEVVNQW 31 AE +V +TKL L EE Q+ G+SND+ +I++E +KA + A+ R + VN W Sbjct: 2 AEPVVSFLLTKLDQLLTEEVQLLSGVSNDVRWINDELRSIKAFLNDADNVRETNTSVNAW 61 Query: 30 LELVRDEAY 4 +E V+D AY Sbjct: 62 VEQVQDVAY 70 >ref|XP_002528440.1| Disease resistance protein RPP8, putative [Ricinus communis] gi|223532116|gb|EEF33923.1| Disease resistance protein RPP8, putative [Ricinus communis] Length = 920 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/69 (33%), Positives = 44/69 (63%) Frame = -3 Query: 210 AEALVKSAITKLKDLAIEEWQIQRGISNDINFISNEFSMMKAVIRKAEKRRVRDEVVNQW 31 AEA+V SA+ ++ L I+E + G+SN++ + E + M+ ++ A++++ +DE V W Sbjct: 2 AEAIVSSAVDRISHLLIQEADLLLGVSNEVKLLRAELTRMQGFLQDADRKQEQDECVRNW 61 Query: 30 LELVRDEAY 4 + +RD AY Sbjct: 62 VTEIRDAAY 70