BLASTX nr result
ID: Akebia24_contig00033827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00033827 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349117.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 ref|XP_004251045.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 emb|CBI28351.3| unnamed protein product [Vitis vinifera] 79 5e-13 ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 gb|EYU36955.1| hypothetical protein MIMGU_mgv1a019924mg, partial... 79 7e-13 ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_007015858.1| Tetratricopeptide repeat (TPR)-like superfam... 78 1e-12 ref|XP_002306231.2| hypothetical protein POPTR_0004s19560g [Popu... 77 2e-12 gb|AFG65806.1| hypothetical protein 2_9455_01, partial [Pinus ta... 77 2e-12 ref|XP_006487970.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] 77 2e-12 gb|AEX11933.1| hypothetical protein 0_18068_02 [Pinus taeda] 77 2e-12 gb|AEX11932.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|... 77 2e-12 ref|XP_004163716.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 77 3e-12 ref|XP_004139569.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 gb|AFG65812.1| hypothetical protein 2_9455_01, partial [Pinus ta... 76 6e-12 gb|AFW77609.1| hypothetical protein ZEAMMB73_798524 [Zea mays] 75 7e-12 gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus ta... 75 7e-12 gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus ta... 75 7e-12 gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus ra... 75 7e-12 >ref|XP_006349117.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Solanum tuberosum] Length = 871 Score = 79.7 bits (195), Expect = 4e-13 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCH ++L+SK+EGR+I VRD NRFHHFK G CSCG YW Sbjct: 829 RVCGDCHTVIKLISKIEGRQIVVRDSNRFHHFKGGLCSCGDYW 871 >ref|XP_004251045.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Solanum lycopersicum] Length = 871 Score = 79.7 bits (195), Expect = 4e-13 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCH ++L+SK+EGR+I VRD NRFHHFK G CSCG YW Sbjct: 829 RVCGDCHTVIKLISKIEGRQIVVRDSNRFHHFKGGLCSCGDYW 871 >emb|CBI28351.3| unnamed protein product [Vitis vinifera] Length = 770 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCH ++L+SK+EGR+I VRD NRFHHFK G CSCG YW Sbjct: 728 RVCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 770 >ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Vitis vinifera] Length = 866 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCH ++L+SK+EGR+I VRD NRFHHFK G CSCG YW Sbjct: 824 RVCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 866 >gb|EYU36955.1| hypothetical protein MIMGU_mgv1a019924mg, partial [Mimulus guttatus] Length = 825 Score = 79.0 bits (193), Expect = 7e-13 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCH ++L+SKLEGREI VRD NRFHHF G CSCG YW Sbjct: 783 RVCGDCHAVIKLISKLEGREIIVRDSNRFHHFSEGLCSCGDYW 825 >ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Fragaria vesca subsp. vesca] Length = 755 Score = 78.2 bits (191), Expect = 1e-12 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 RICGDCH ++ +S LEGREI+VRD NRFHHFK G CSCG YW Sbjct: 713 RICGDCHSVIKFISSLEGREISVRDTNRFHHFKDGVCSCGDYW 755 >ref|XP_007015858.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508786221|gb|EOY33477.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 875 Score = 77.8 bits (190), Expect = 1e-12 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCH ++L+S +EGREI VRD NRFHHF+AG CSCG YW Sbjct: 833 RVCGDCHTVIKLISLIEGREIVVRDTNRFHHFQAGSCSCGDYW 875 >ref|XP_002306231.2| hypothetical protein POPTR_0004s19560g [Populus trichocarpa] gi|550341393|gb|EEE86742.2| hypothetical protein POPTR_0004s19560g [Populus trichocarpa] Length = 732 Score = 77.4 bits (189), Expect = 2e-12 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCH ++L+S LEGR+I VRD NRFHHFK G CSCG YW Sbjct: 690 RVCGDCHSVIKLISILEGRDIVVRDSNRFHHFKGGLCSCGDYW 732 >gb|AFG65806.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165806|gb|AFG65807.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 77.4 bits (189), Expect = 2e-12 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCHRT + +SK+ GREI +RD NRFHHFK G CSCG YW Sbjct: 114 RVCGDCHRTTKFISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >ref|XP_006487970.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] Length = 873 Score = 77.0 bits (188), Expect = 2e-12 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCH ++L+SKLE R+I VRD NRFHHFK G CSCG YW Sbjct: 831 RVCGDCHTVIKLISKLERRDIVVRDTNRFHHFKEGLCSCGDYW 873 >gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] Length = 662 Score = 77.0 bits (188), Expect = 2e-12 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 RICGDCH M+ +S EGREI+VRD NRFHHFK G CSCG YW Sbjct: 620 RICGDCHEAMKFISCFEGREISVRDTNRFHHFKDGKCSCGDYW 662 >gb|AEX11933.1| hypothetical protein 0_18068_02 [Pinus taeda] Length = 80 Score = 77.0 bits (188), Expect = 2e-12 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+C DCH +SK+ GREI VRD NRFHHFKAG CSCGGYW Sbjct: 38 RVCNDCHNATTFISKIVGREIIVRDANRFHHFKAGLCSCGGYW 80 >gb|AEX11932.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063454|gb|AEX11934.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063456|gb|AEX11935.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063458|gb|AEX11936.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063460|gb|AEX11937.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063462|gb|AEX11938.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063464|gb|AEX11939.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063466|gb|AEX11940.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063468|gb|AEX11941.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063470|gb|AEX11942.1| hypothetical protein 0_18068_02 [Pinus taeda] Length = 80 Score = 77.0 bits (188), Expect = 2e-12 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+C DCH +SK+ GREI VRD NRFHHFKAG CSCGGYW Sbjct: 38 RVCNDCHNATTFISKIVGREIIVRDANRFHHFKAGLCSCGGYW 80 >ref|XP_004163716.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g27610-like [Cucumis sativus] Length = 878 Score = 76.6 bits (187), Expect = 3e-12 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 RICGDCH +EL+S +E R + VRD NRFHHFK G CSCGGYW Sbjct: 836 RICGDCHNVIELISLIEERTLIVRDSNRFHHFKGGVCSCGGYW 878 >ref|XP_004139569.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Cucumis sativus] Length = 878 Score = 76.6 bits (187), Expect = 3e-12 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 RICGDCH +EL+S +E R + VRD NRFHHFK G CSCGGYW Sbjct: 836 RICGDCHNVIELISLIEERTLIVRDSNRFHHFKGGVCSCGGYW 878 >gb|AFG65812.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165818|gb|AFG65813.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 75.9 bits (185), Expect = 6e-12 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCHR + +SK+ GREI +RD NRFHHFK G CSCG YW Sbjct: 114 RVCGDCHRATKFISKVVGREINMRDANRFHHFKDGLCSCGDYW 156 >gb|AFW77609.1| hypothetical protein ZEAMMB73_798524 [Zea mays] Length = 665 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 RICGDCH M+ +S EGREI+VRD NRFHHF G CSCG +W Sbjct: 623 RICGDCHEAMKFISSFEGREISVRDTNRFHHFSGGKCSCGDFW 665 >gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCHR + +SK+ GREI +RD NRFHHFK G CSCG YW Sbjct: 114 RVCGDCHRATKFISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165802|gb|AFG65805.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165820|gb|AFG65814.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCHR + +SK+ GREI +RD NRFHHFK G CSCG YW Sbjct: 114 RVCGDCHRATKFISKVVGREIIMRDANRFHHFKDGLCSCGDYW 156 >gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus radiata] gi|383165794|gb|AFG65801.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165798|gb|AFG65803.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165808|gb|AFG65808.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165812|gb|AFG65810.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165814|gb|AFG65811.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +2 Query: 2 RICGDCHRTMELVSKLEGREITVRDRNRFHHFKAGYCSCGGYW 130 R+CGDCHR + +SK+ GREI +RD NRFHHFK G CSCG YW Sbjct: 114 RVCGDCHRATKFISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156