BLASTX nr result
ID: Akebia24_contig00033589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00033589 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EWG43757.1| histone H2B [Fusarium verticillioides 7600] 64 2e-08 ref|XP_001219687.1| histone H2B [Chaetomium globosum CBS 148.51]... 64 2e-08 sp|Q4HTT2.3|H2B_GIBZE RecName: Full=Histone H2B gi|558866413|gb|... 64 2e-08 emb|CCU74996.1| histone 2B [Blumeria graminis f. sp. hordei DH14] 64 2e-08 gb|EPS40138.1| hypothetical protein H072_6093 [Dactylellina hapt... 64 2e-08 gb|EPQ62221.1| hypothetical protein BGT96224_A20112 [Blumeria gr... 64 2e-08 gb|EOO02542.1| putative histone h2b protein [Togninia minima UCR... 64 2e-08 ref|XP_007584397.1| putative histone h2b protein [Neofusicoccum ... 64 2e-08 gb|ENH77226.1| histone h2b [Colletotrichum orbiculare MAFF 240422] 64 2e-08 gb|EMF09034.1| histone H2B [Sphaerulina musiva SO2202] 64 2e-08 gb|EMC99637.1| hypothetical protein BAUCODRAFT_30007 [Baudoinia ... 64 2e-08 ref|XP_007285348.1| histone h2b [Colletotrichum gloeosporioides ... 64 2e-08 ref|XP_002999954.1| histone H2B [Verticillium alfalfae VaMs.102]... 64 2e-08 gb|EJT75322.1| histone H2B [Gaeumannomyces graminis var. tritici... 64 2e-08 gb|EJP61108.1| histone H2B [Beauveria bassiana ARSEF 2860] 64 2e-08 gb|EHY58297.1| histone H2B [Exophiala dermatitidis NIH/UT8656] g... 64 2e-08 gb|EHL00037.1| putative Histone H2B [Glarea lozoyensis 74030] gi... 64 2e-08 gb|EHK43662.1| hypothetical protein TRIATDRAFT_300144 [Trichoder... 64 2e-08 ref|XP_003665421.1| histone H2B-like protein [Myceliophthora the... 64 2e-08 ref|XP_003654108.1| histone H2B-like protein [Thielavia terrestr... 64 2e-08 >gb|EWG43757.1| histone H2B [Fusarium verticillioides 7600] Length = 138 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 35 SGDKKKRSKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 75 >ref|XP_001219687.1| histone H2B [Chaetomium globosum CBS 148.51] gi|110279006|sp|Q2HH38.3|H2B_CHAGB RecName: Full=Histone H2B gi|88184763|gb|EAQ92231.1| histone H2B [Chaetomium globosum CBS 148.51] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRTKARKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >sp|Q4HTT2.3|H2B_GIBZE RecName: Full=Histone H2B gi|558866413|gb|ESU16496.1| histone H2B [Fusarium graminearum PH-1] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRSKSRKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >emb|CCU74996.1| histone 2B [Blumeria graminis f. sp. hordei DH14] Length = 132 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 32 SGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 72 >gb|EPS40138.1| hypothetical protein H072_6093 [Dactylellina haptotyla CBS 200.50] Length = 141 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 37 SGDKKKRTKARKETYSSYIYKVLKQVHPDTGISNRAMSILN 77 >gb|EPQ62221.1| hypothetical protein BGT96224_A20112 [Blumeria graminis f. sp. tritici 96224] Length = 135 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 32 SGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 72 >gb|EOO02542.1| putative histone h2b protein [Togninia minima UCRPA7] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRTKARKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >ref|XP_007584397.1| putative histone h2b protein [Neofusicoccum parvum UCRNP2] gi|485922786|gb|EOD48114.1| putative histone h2b protein [Neofusicoccum parvum UCRNP2] Length = 138 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 35 SGDKKKRTKSRKETYSSYIYKVLKQVHPDTGISNRAMSILN 75 >gb|ENH77226.1| histone h2b [Colletotrichum orbiculare MAFF 240422] Length = 154 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRTKSRKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >gb|EMF09034.1| histone H2B [Sphaerulina musiva SO2202] Length = 140 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 37 SGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 77 >gb|EMC99637.1| hypothetical protein BAUCODRAFT_30007 [Baudoinia compniacensis UAMH 10762] Length = 141 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 38 SGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 78 >ref|XP_007285348.1| histone h2b [Colletotrichum gloeosporioides Nara gc5] gi|429850314|gb|ELA25602.1| histone h2b [Colletotrichum gloeosporioides Nara gc5] gi|530474038|gb|EQB54346.1| histone H2B [Colletotrichum gloeosporioides Cg-14] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRTKSRKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >ref|XP_002999954.1| histone H2B [Verticillium alfalfae VaMs.102] gi|389637389|ref|XP_003716332.1| histone H2B [Magnaporthe oryzae 70-15] gi|544604123|sp|P0CT13.1|H2B_MAGO7 RecName: Full=Histone H2B gi|544604125|sp|L7I1W3.1|H2B_MAGOY RecName: Full=Histone H2B gi|58257463|gb|AAW69353.1| histone H2B-like protein [Magnaporthe grisea] gi|261361136|gb|EEY23564.1| histone H2B [Verticillium alfalfae VaMs.102] gi|346975629|gb|EGY19081.1| histone H2B [Verticillium dahliae VdLs.17] gi|351642151|gb|EHA50013.1| histone H2B [Magnaporthe oryzae 70-15] gi|440467302|gb|ELQ36532.1| histone H2B [Magnaporthe oryzae Y34] gi|440478909|gb|ELQ59707.1| histone H2B [Magnaporthe oryzae P131] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >gb|EJT75322.1| histone H2B [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 138 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 35 SGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 75 >gb|EJP61108.1| histone H2B [Beauveria bassiana ARSEF 2860] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >gb|EHY58297.1| histone H2B [Exophiala dermatitidis NIH/UT8656] gi|589990583|gb|EXJ73233.1| histone H2B [Cladophialophora psammophila CBS 110553] gi|590014555|gb|EXJ89757.1| histone H2B [Capronia epimyces CBS 606.96] gi|590020353|gb|EXJ95550.1| histone H2B [Capronia coronata CBS 617.96] Length = 141 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 38 SGDKKKRGKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 78 >gb|EHL00037.1| putative Histone H2B [Glarea lozoyensis 74030] gi|512205730|gb|EPE34551.1| Histone-fold containing protein [Glarea lozoyensis ATCC 20868] Length = 136 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 33 SGDKKKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 73 >gb|EHK43662.1| hypothetical protein TRIATDRAFT_300144 [Trichoderma atroviride IMI 206040] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRSKTRKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >ref|XP_003665421.1| histone H2B-like protein [Myceliophthora thermophila ATCC 42464] gi|347012692|gb|AEO60176.1| histone H2B-like protein [Myceliophthora thermophila ATCC 42464] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRSKARKETYSSYIYKVLKQVHPDTGISNRAMSILN 74 >ref|XP_003654108.1| histone H2B-like protein [Thielavia terrestris NRRL 8126] gi|347001371|gb|AEO67772.1| histone H2B-like protein [Thielavia terrestris NRRL 8126] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 187 SGDXXXXXXXXXETYSSYIYKVLKQVHPDTGISNRAMSILN 309 SGD ETYSSYIYKVLKQVHPDTGISNRAMSILN Sbjct: 34 SGDKKKRTKARKETYSSYIYKVLKQVHPDTGISNRAMSILN 74