BLASTX nr result
ID: Akebia24_contig00033585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00033585 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70261.1| hypothetical protein VITISV_002224 [Vitis vinifera] 56 5e-06 >emb|CAN70261.1| hypothetical protein VITISV_002224 [Vitis vinifera] Length = 430 Score = 56.2 bits (134), Expect = 5e-06 Identities = 20/43 (46%), Positives = 29/43 (67%) Frame = +1 Query: 4 KWFLCFGVDRDSPWRRVIKGKYGEDPMGWEYGPFRSSYGCNFW 132 KW+ CF + DS W+++I+GK+GE+ GW+ G R SYG W Sbjct: 310 KWYCCFASEGDSLWKKIIRGKFGEEEEGWKSGVVRDSYGFRAW 352