BLASTX nr result
ID: Akebia24_contig00033571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00033571 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828760.1| hypothetical protein AMTR_s00001p00076430 [A... 58 8e-07 >ref|XP_006828760.1| hypothetical protein AMTR_s00001p00076430 [Amborella trichopoda] gi|548833739|gb|ERM96176.1| hypothetical protein AMTR_s00001p00076430 [Amborella trichopoda] Length = 372 Score = 57.8 bits (138), Expect(2) = 8e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 215 LKIISNWRFKSEEHPVIASNTKERLLVLIFASPRAHTMNGPLP 87 L+I+SN R+KS EH V+AS +KER+ + IF SPR HTM GPLP Sbjct: 292 LEILSNGRYKSAEHRVMASGSKERVSIPIFVSPRPHTMIGPLP 334 Score = 20.8 bits (42), Expect(2) = 8e-07 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 85 GDYMANTPRGADQGKNS 35 G+YMAN QGK+S Sbjct: 350 GEYMANYFGAGHQGKSS 366