BLASTX nr result
ID: Akebia24_contig00033299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00033299 (858 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007037975.1| Pentatricopeptide repeat superfamily protein... 74 5e-11 emb|CBI15662.3| unnamed protein product [Vitis vinifera] 74 5e-11 ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-11 emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] 74 5e-11 ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containi... 74 7e-11 ref|XP_006477030.1| PREDICTED: pentatricopeptide repeat-containi... 72 3e-10 ref|XP_006440110.1| hypothetical protein CICLE_v10019093mg [Citr... 72 3e-10 ref|XP_006367434.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-09 ref|XP_004243699.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-09 ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-09 ref|XP_003531467.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-09 ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_007217008.1| hypothetical protein PRUPE_ppa002164mg [Prun... 68 4e-09 ref|XP_004499791.1| PREDICTED: pentatricopeptide repeat-containi... 68 5e-09 ref|XP_004304293.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_003571366.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 gb|EXB31957.1| hypothetical protein L484_013589 [Morus notabilis] 67 9e-09 gb|EMT12320.1| hypothetical protein F775_11049 [Aegilops tauschii] 67 1e-08 ref|XP_004293115.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-08 gb|EYU39273.1| hypothetical protein MIMGU_mgv1a025401mg [Mimulus... 66 1e-08 >ref|XP_007037975.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508775220|gb|EOY22476.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 702 Score = 74.3 bits (181), Expect = 5e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIA+VTRREIVVRDASRFHHFKDG+CSCGDYW Sbjct: 669 IKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >emb|CBI15662.3| unnamed protein product [Vitis vinifera] Length = 657 Score = 74.3 bits (181), Expect = 5e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIA+VTRREIVVRDASRFHHFKDG+CSCGDYW Sbjct: 624 IKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 657 >ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Vitis vinifera] Length = 704 Score = 74.3 bits (181), Expect = 5e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIA+VTRREIVVRDASRFHHFKDG+CSCGDYW Sbjct: 671 IKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704 >emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] Length = 704 Score = 74.3 bits (181), Expect = 5e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIA+VTRREIVVRDASRFHHFKDG+CSCGDYW Sbjct: 671 IKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704 >ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cucumis sativus] gi|449517215|ref|XP_004165641.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cucumis sativus] Length = 706 Score = 73.9 bits (180), Expect = 7e-11 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +1 Query: 1 VIKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 VIKLIAM+T+REIV+RDASRFHHF+DG+CSCGDYW Sbjct: 672 VIKLIAMITKREIVIRDASRFHHFRDGSCSCGDYW 706 >ref|XP_006477030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Citrus sinensis] Length = 703 Score = 72.0 bits (175), Expect = 3e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIAMVT REIVVRDASRFHHFKDG CSCGDYW Sbjct: 670 IKLIAMVTGREIVVRDASRFHHFKDGMCSCGDYW 703 >ref|XP_006440110.1| hypothetical protein CICLE_v10019093mg [Citrus clementina] gi|557542372|gb|ESR53350.1| hypothetical protein CICLE_v10019093mg [Citrus clementina] Length = 703 Score = 72.0 bits (175), Expect = 3e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIAMVT REIVVRDASRFHHFKDG CSCGDYW Sbjct: 670 IKLIAMVTGREIVVRDASRFHHFKDGICSCGDYW 703 >ref|XP_006367434.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Solanum tuberosum] Length = 700 Score = 70.1 bits (170), Expect = 1e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIAM+T+REIV+RDASRFH FK+GTCSCGDYW Sbjct: 667 IKLIAMITKREIVIRDASRFHRFKNGTCSCGDYW 700 >ref|XP_004243699.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Solanum lycopersicum] Length = 704 Score = 70.1 bits (170), Expect = 1e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIAM+T+REIV+RDASRFH FK+GTCSCGDYW Sbjct: 671 IKLIAMITKREIVIRDASRFHRFKNGTCSCGDYW 704 >ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 690 Score = 70.1 bits (170), Expect = 1e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IK IAMVT REIVVRDASRFHHF+DG+CSCGDYW Sbjct: 657 IKFIAMVTGREIVVRDASRFHHFRDGSCSCGDYW 690 >ref|XP_003531467.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 691 Score = 69.7 bits (169), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIAMVT REIVVRDASRFHHF++G+CSCGDYW Sbjct: 658 IKLIAMVTGREIVVRDASRFHHFRNGSCSCGDYW 691 >ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Fragaria vesca subsp. vesca] Length = 867 Score = 68.9 bits (167), Expect = 2e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +1 Query: 1 VIKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 V KLI+++T REI+VRD++RFHHFKDGTCSCGDYW Sbjct: 833 VTKLISVITEREIIVRDSNRFHHFKDGTCSCGDYW 867 >ref|XP_007217008.1| hypothetical protein PRUPE_ppa002164mg [Prunus persica] gi|462413158|gb|EMJ18207.1| hypothetical protein PRUPE_ppa002164mg [Prunus persica] Length = 706 Score = 68.2 bits (165), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 +KLIA VT REIVVRDASRFHHFKDG+CSCG+YW Sbjct: 673 VKLIARVTGREIVVRDASRFHHFKDGSCSCGNYW 706 >ref|XP_004499791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cicer arietinum] Length = 691 Score = 67.8 bits (164), Expect = 5e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIA+VT REIV+RDASRFHHFK+G CSCGDYW Sbjct: 658 IKLIALVTGREIVLRDASRFHHFKNGRCSCGDYW 691 >ref|XP_004304293.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 707 Score = 67.4 bits (163), Expect = 7e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIA VT REIVVRDASRFHHFK+G+CSCG+YW Sbjct: 674 IKLIAKVTEREIVVRDASRFHHFKNGSCSCGNYW 707 >ref|XP_003571366.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Brachypodium distachyon] Length = 674 Score = 67.4 bits (163), Expect = 7e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 VIKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 V+KL+A VT+REIV+RD SRFHHFK GTCSCGDYW Sbjct: 640 VMKLVAQVTKREIVLRDGSRFHHFKLGTCSCGDYW 674 >gb|EXB31957.1| hypothetical protein L484_013589 [Morus notabilis] Length = 699 Score = 67.0 bits (162), Expect = 9e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLI MV+ REIV+RD SRFHHFKDG+CSCGDYW Sbjct: 666 IKLITMVSGREIVLRDGSRFHHFKDGSCSCGDYW 699 >gb|EMT12320.1| hypothetical protein F775_11049 [Aegilops tauschii] Length = 504 Score = 66.6 bits (161), Expect = 1e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 VIKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 VIK + VT+REI VRDASRFHHFK GTCSCGDYW Sbjct: 470 VIKFVTQVTKREITVRDASRFHHFKLGTCSCGDYW 504 >ref|XP_004293115.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Fragaria vesca subsp. vesca] Length = 870 Score = 66.6 bits (161), Expect = 1e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 1 VIKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 VIKLI++VT RE++VRD RFHHFKDG CSCGDYW Sbjct: 836 VIKLISVVTSRELIVRDGHRFHHFKDGCCSCGDYW 870 >gb|EYU39273.1| hypothetical protein MIMGU_mgv1a025401mg [Mimulus guttatus] Length = 631 Score = 66.2 bits (160), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 4 IKLIAMVTRREIVVRDASRFHHFKDGTCSCGDYW 105 IKLIA VTRREI++RDA+RFHHFKDG CSC DYW Sbjct: 598 IKLIANVTRREIILRDANRFHHFKDGLCSCRDYW 631