BLASTX nr result
ID: Akebia24_contig00033295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00033295 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274344.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002533676.1| pentatricopeptide repeat-containing protein,... 62 6e-08 >ref|XP_002274344.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Vitis vinifera] Length = 739 Score = 64.3 bits (155), Expect = 2e-08 Identities = 38/101 (37%), Positives = 51/101 (50%), Gaps = 1/101 (0%) Frame = +1 Query: 43 TILFNLHHRIPCISTVKFPSXXXXXXXXXXXXXQTICPSIITSCTDLQTLKQIHA-LFLC 219 ++LF HH T FP S++ SC +LQ LK+IHA L + Sbjct: 35 SVLFRTHHLNSHYLTCSFPYS-----------------SLLHSCNNLQALKRIHASLIVS 77 Query: 220 HGFKLISIAPKLITQYANFEDLGSALSIFKALSEPNTFLWN 342 GF+ +S+A KLIT Y+ D SA SI + EPNT +WN Sbjct: 78 SGFQPLSVASKLITLYSQLNDFRSAFSICNSFEEPNTVIWN 118 >ref|XP_002533676.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526427|gb|EEF28706.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 726 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +1 Query: 157 SIITSCTDLQTLKQIHA-LFLCHGFKLISIAP--KLITQYANFEDLGSALSIFKALSEPN 327 S++ SC DL+TLKQIHA L + GF P KLI+ Y+ F DL SA+S+F L EPN Sbjct: 33 SLLHSCKDLRTLKQIHASLLVSTGFNESISFPSTKLISFYSKFNDLESAISVFSLLQEPN 92 Query: 328 TFLWNL 345 T WNL Sbjct: 93 TLSWNL 98